DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3108 and klf7

DIOPT Version :9

Sequence 1:NP_572262.1 Gene:CG3108 / 31506 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:NP_001072934.1 Gene:klf7 / 780396 XenbaseID:XB-GENE-1012735 Length:296 Species:Xenopus tropicalis


Alignment Length:133 Identity:31/133 - (23%)
Similarity:52/133 - (39%) Gaps:14/133 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 VELPSDITVAESQPETEHDTENDQQQPESIEEHVVLMKPAS---------QEAQLEQTVDLATEA 188
            :.:|.||:..|.:|..:.....|    :.:.|..|.::|||         .:|||.....|...:
 Frog    80 IVIPVDISAYEKRPSMDVLLSQD----KLLSETCVSLQPASSATECYTSVNQAQLNAVTSLTPPS 140

  Fly   189 APVPLNDELPEDEESPAATESAVEELEKESEAAMDDQVPEESEIQPEQVQPGEYQSESDGEQAET 253
            :| .|:..|.:..:|.:|.:..|.......:|::......||.......:.|...||..|...|.
 Frog   141 SP-ELSRHLVKTPQSLSAVDGTVTLKLVAKKASVSLGKAAESASTAVTSKCGLSDSEQTGGPGEA 204

  Fly   254 KPE 256
            .||
 Frog   205 SPE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416
M14_CP_A-B_like 821..1112 CDD:199844
klf7NP_001072934.1 COG5048 193..>278 CDD:227381 6/15 (40%)
C2H2 Zn finger 218..237 CDD:275368
C2H2 Zn finger 245..267 CDD:275368
zf-C2H2 273..295 CDD:333835
C2H2 Zn finger 275..295 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X86
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.