DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3108 and Cpo

DIOPT Version :9

Sequence 1:NP_572262.1 Gene:CG3108 / 31506 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:XP_038940238.1 Gene:Cpo / 689717 RGDID:1588771 Length:325 Species:Rattus norvegicus


Alignment Length:321 Identity:78/321 - (24%)
Similarity:127/321 - (39%) Gaps:65/321 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   817 TWQAYHRL-EDIHGFIDYMAKTYPDICSTEIIGYSVEKRPLKILK------ISNGNARNPGIWID 874
            ::..||.. ..|:.::..:::.|.::.:...:..:.|..|:..||      :::.|::.. ||||
  Rat    21 SYDRYHPWGRGIYQWMRQVSEKYAEVLTQHFLRMTYETWPMHYLKESAEISLTSSNSKKT-IWID 84

  Fly   875 GGMHAREWISPA------------TVTYIANQLVEGWEDL---PEHMRSINW---YIHP------ 915
            .|:||..||:||            |...:.|..:|....|   ..:...:||   .:.|      
  Rat    85 CGIHASRWIAPAFCQWFLREGSVFTCLLMLNHAIEYLSTLGSSETYFFPVNWNGIQLAPLQILQN 149

  Fly   916 -----------------VANPDGYEYSHTTDRLWRKNMRAHGRQCPGVDLNRNFGYKWGGKGTSA 963
                             |.|.||..|:.||  .|...: ..|..|..:             ||..
  Rat   150 DKDSARIGRLLKELDFXVLNADGXIYTWTT--AWTLPV-GQGYLCLHI-------------GTPI 198

  Fly   964 SPCSQTYRGSKAFSEPETFYISKFISGFPRETFQAYLSFHSYGQYILYPWGYDYQLTQDRADLDR 1028
            :....|:.|.:...|||............::....:|...||||.||.|:|:......:..:|.:
  Rat   199 NCQDVTFCGIEPMLEPELTPSQALQKARGKKDILCFLIMGSYGQLILTPYGHTKNKPHNYEELIQ 263

  Fly  1029 VARQAGTSITKSTGVKYTVGSSATTLYPAAGGSDDWAKGIAGIKYAYTIEMGDTGRYGFVL 1089
            |.::|..::....|..|.|||.|..||..:|.|.||..||....::||.|:.|.|.:||.|
  Rat   264 VGQKAARALKAKHGTNYRVGSGADILYMLSGSSKDWNGGIGIPLFSYTFELVDNGTHGFAL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416
M14_CP_A-B_like 821..1112 CDD:199844 78/317 (25%)
CpoXP_038940238.1 Peptidase_M14_like 22..324 CDD:416253 77/318 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.