DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3108 and AgaP_AGAP012355

DIOPT Version :9

Sequence 1:NP_572262.1 Gene:CG3108 / 31506 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:XP_001689235.1 Gene:AgaP_AGAP012355 / 5667851 VectorBaseID:AGAP012355 Length:208 Species:Anopheles gambiae


Alignment Length:210 Identity:50/210 - (23%)
Similarity:85/210 - (40%) Gaps:23/210 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   431 EQEKEKEPEQITLADETEQDSAQPSNEEPVEIAPEQHTEA-----EIAPAKIPEEGKPEEEVQVE 490
            :|:..:||    |.|  ::.|.|.|.||  ...|:|..||     :.:.....:.|:.:|. |:|
Mosquito     1 DQKHLQEP----LYD--QKYSQQHSYEE--NYHPQQSYEAYNYGQQHSDGNYVDYGEHDEH-QIE 56

  Fly   491 EESKPVEESKPEEEIKQQEDAKPEEDDQNYAETQPAVTEVKPEETPADIPVEIPAEVPAEIPAEI 555
               |...:|........|:......:|....|.:..:|:..|...|.::...:|.||....|.|:
Mosquito    57 ---KVPHDSYESYGYDHQQSHGYYGNDYVQKEVKQVITKKVPVPYPVEVEKHVPVEVKVPYPVEV 118

  Fly   556 PAEVPAEIPAESPAEIAAEVPAEIPAEIPAE--IPAETPA--ETHAEIPADVPAQVVAEAPAETP 616
            ..:||..:..:.|..:..:||..:....|.|  :|...|.  :.:.|:|.  |..|..|.|....
Mosquito   119 EKKVPVVVEKKVPVYVEKKVPVHVDRPYPVEVKVPVHVPVYKKEYVEVPK--PYAVHVEKPYPVY 181

  Fly   617 AETPAEVPAEIPSKV 631
            .:.|..|..::|..|
Mosquito   182 VKQPVYVEKQVPVTV 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416
M14_CP_A-B_like 821..1112 CDD:199844
AgaP_AGAP012355XP_001689235.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.