DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3108 and AgaP_AGAP008372

DIOPT Version :9

Sequence 1:NP_572262.1 Gene:CG3108 / 31506 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:XP_001237882.1 Gene:AgaP_AGAP008372 / 4577986 VectorBaseID:AGAP008372 Length:197 Species:Anopheles gambiae


Alignment Length:178 Identity:56/178 - (31%)
Similarity:99/178 - (55%) Gaps:13/178 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   723 YDGAQVWRIVVQTDKDKRMADELQSKYDGQLW----KEVKQEVDYLLKPQVLAAAERHIRAANLS 783
            |:...|:|:.:.::|...:...|:|..:|..:    ..|.:.|:.::.|..:..|:|..|...::
Mosquito    27 YENYAVYRVDIASEKQLAVLQHLESLPNGYTFLDFPSSVNKSVEVVIPPSEVVNAQRLFRQHGIT 91

  Fly   784 RIVLIDNLQRVIEKENPPAEKIAELQNRKGHRLTWQAYHRLEDIHGFIDYMAKTYPDICSTEIIG 848
            ..::..||::::::|.|        ..||.....|..||.||:|:.::|.|...|..:.|.|.||
Mosquito    92 NSLITGNLKQILDQERP--------ARRKAEGFGWTDYHTLEEIYAWLDEMVAQYSTVLSVETIG 148

  Fly   849 YSVEKRPLKILKISNGNARNPGIWIDGGMHAREWISPATVTYIANQLV 896
            .:.|||.:|::|:|. .|.|.||:||..:||||||:.||||::.|:|:
Mosquito   149 QTYEKRDMKVIKLSY-KAGNQGIFIDANIHAREWITSATVTWLLNELL 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416 13/70 (19%)
M14_CP_A-B_like 821..1112 CDD:199844 36/76 (47%)
AgaP_AGAP008372XP_001237882.1 Propep_M14 34..105 CDD:280416 13/70 (19%)
Peptidase_M14_like 121..>197 CDD:299699 36/76 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X86
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.