DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3108 and Cpa5

DIOPT Version :9

Sequence 1:NP_572262.1 Gene:CG3108 / 31506 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:NP_001002808.2 Gene:Cpa5 / 408212 RGDID:1303098 Length:436 Species:Rattus norvegicus


Alignment Length:384 Identity:135/384 - (35%)
Similarity:221/384 - (57%) Gaps:25/384 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   723 YDGAQVWRIVVQTDKDKRMADELQ----SKYDGQLWK-------EVKQEVDYLLKPQVLAAAERH 776
            :.|.||.|::.:.:|...:..:|:    .|.|  .|:       .|...|.:...|.|.|    :
  Rat    37 FTGDQVLRVLAKNEKQLSLLRDLEIQKPQKVD--FWRGPARPSLPVDMRVPFSELPSVKA----Y 95

  Fly   777 IRAANLSRIVLIDNLQRVIEKENPPAEKIAELQNRKGHRLTWQAYHRLEDIHGFIDYMAKTYPDI 841
            :::..|:..|:|.::|.::::|.....:...|: |..:..::.:||.||:|:.:||.....:.::
  Rat    96 LKSHGLAYSVMIKDIQVLLDEERDAMARSRRLE-RSTNGFSYSSYHTLEEIYNWIDNFVAEHSNL 159

  Fly   842 CSTEIIGYSVEKRPLKILKISNGNARNPGIWIDGGMHAREWISPATVTYIANQLVEGWED---LP 903
            .|...||.|.|.|.:.:||.|.|......||||.|:|:||||:.||..:|:.::|..:..   |.
  Rat   160 VSKIHIGKSFENRSILVLKFSTGGPNRTAIWIDTGIHSREWITHATGIWISQKIVNAYSKDHVLK 224

  Fly   904 EHMRSINWYIHPVANPDGYEYSHTTDRLWRKNMRAH-GRQCPGVDLNRNFGYKWGGKGTSASPCS 967
            :.:.:::.:|..|.||||:.::|:.:||||||.... |..|.|||||||:...:||.|::.:|||
  Rat   225 KVLNTMDIFIEIVTNPDGFAFTHSMNRLWRKNKSIQPGIVCVGVDLNRNWRTGFGGNGSNKNPCS 289

  Fly   968 QTYRGSKAFSEPETFYISKFISGFPRETFQAYLSFHSYGQYILYPWGYDYQLTQDRADLDRVARQ 1032
            :||||....||||...|..||:|  ...|:|.:|.|||.|.::||:|:..:...:..:|..:|:.
  Rat   290 ETYRGPAPESEPEVAAIVAFITG--HGNFKAMISIHSYSQMVMYPYGHSLEPVPNHKELFELAKD 352

  Fly  1033 AGTSITKSTGVKYTVGSSATTLYPAAGGSDDWAKGIAGIKYAYTIEMGDTGRYGFVLPA 1091
            |..::.|..|::|..||.:||||.|:|.:.|||.. :|||||::.|:.|||:|||:|||
  Rat   353 AVKALYKVHGMEYIFGSISTTLYSASGITVDWAYD-SGIKYAFSFELRDTGQYGFLLPA 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416 15/77 (19%)
M14_CP_A-B_like 821..1112 CDD:199844 114/275 (41%)
Cpa5NP_001002808.2 Propep_M14 48..117 CDD:396700 14/74 (19%)
M14_CPA 134..434 CDD:349442 114/280 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351595
Domainoid 1 1.000 222 1.000 Domainoid score I2495
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 1 1.000 - - mtm8927
orthoMCL 1 0.900 - - OOG6_100142
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X86
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.650

Return to query results.
Submit another query.