DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3108 and CG8539

DIOPT Version :9

Sequence 1:NP_572262.1 Gene:CG3108 / 31506 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster


Alignment Length:339 Identity:106/339 - (31%)
Similarity:168/339 - (49%) Gaps:23/339 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   807 ELQNRKGHRLTWQAYHRLEDIHGFIDYMAKTYPDICSTEIIGYSVEKRPLKILKISNGNARNPG- 870
            |::.|:|..|....|...:.|..::|.:|.::.:..:.:.:..:.|.|.||:..|:||:.| || 
  Fly    24 EVRRRRGLMLQLDNYLSYDGIMQYLDELALSHSNRVTLKDVARTYENRALKMAIITNGDGR-PGK 87

  Fly   871 --IWIDGGMHAREWISPATVTYIANQLVEGWEDLPEHMRSINWYIHPVANPDGYEYSHTTDRLWR 933
              |::|..:|:|||::||......::||..:.:..:.:...:|:|.|:|||||||||..|:|.||
  Fly    88 RVIFLDAALHSREWMTPAAALLTIHKLVVEFAENSDLLTDYDWHIMPLANPDGYEYSRNTERYWR 152

  Fly   934 KNMRAHGRQCPGVDLNRNFGYKWG-GKGTSASPCSQTYRGSKAFSEPETFYISKFISGFPRETFQ 997
            .....:|..|.|.:|||||...|. |......||.:.|.||..|||.|...:...:.|.. |:.:
  Fly   153 NTRTPNGGNCFGTNLNRNFAVDWNVGFPELKDPCDENYAGSSPFSEVEARTVRDIMHGLV-ESKR 216

  Fly   998 A--YLSFHSYGQYILYPWGYDYQLTQDRADLDRVARQAGTSITKSTGVKYTVGSSATTLYPAAGG 1060
            |  |||.|:..:.:.|||.||.....::.:.|.:.|.....|.:|||........|.......|.
  Fly   217 AVMYLSLHTANRSVFYPWVYDTDPVSNQKEHDEIGRFVADRILQSTGTFIKTWQYAKYAGTFGGT 281

  Fly  1061 SDDWAKGIAGIKYAYTIEMGDTGR----YGFVLPARFIQYNGKDGVT----FADTV------ARA 1111
            |.|:|. :||...::..||..|||    |.|..|||.|::..::..|    ||:..      :|.
  Fly   282 SMDYAL-LAGFPLSFVFEMSGTGRDHVEYKFFPPARDIRHLAEESWTGIKAFAEKTIEKYPPSRV 345

  Fly  1112 IAQGRGKSVARNSS 1125
            |:......:|.|::
  Fly   346 ISYNPMVKLAENAA 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416
M14_CP_A-B_like 821..1112 CDD:199844 99/310 (32%)
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 98/299 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466930
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.