DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3108 and CG8564

DIOPT Version :9

Sequence 1:NP_572262.1 Gene:CG3108 / 31506 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster


Alignment Length:321 Identity:96/321 - (29%)
Similarity:142/321 - (44%) Gaps:49/321 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   821 YHRLEDIHGFIDYMAKTYPDICSTEIIGYSVEKRPLKILKISNGNARN----------------- 868
            |...:.::.::.|:|:.|.......|:|::.|||.::.|:|:..|:.|                 
  Fly    54 YLDYKQVNQYLQYLAQRYAHFVHVHILGHTHEKREIRALEINWMNSENVELSPQMREHSPRLFDI 118

  Fly   869 -PG-----------------IWIDGGMHAREWISPATVTYIANQLVEGWEDLPEHMRSINWYIHP 915
             |.                 ::|:.|.|||||||.:|......||.|.:....|.:|.:.:.|.|
  Fly   119 GPNGRFTVPVIHVGEHCRKTVFIEAGTHAREWISVSTALNCIYQLTERYTRNIEVLRKLRFIIVP 183

  Fly   916 VANPDGYEYSHTTDRLWRKNMRAH-GRQCPGVDLNRNFGYKWGGKGTSASPCSQTYRGSKAFSEP 979
            :.||||||||.|.:..||||.|.| ..:..|.|.|||:...|....:..:  ..||:|...||||
  Fly   184 LVNPDGYEYSRTKNPKWRKNRRPHKSAKFVGTDCNRNYDIFWNSGPSKIN--RNTYKGESPFSEP 246

  Fly   980 ETFYISKFISGFPRETFQAYLSFHSYGQYILYPWGYDYQLTQDR----ADLDRVARQAGTSITKS 1040
            || ...:.|..........:||.|||||.|:|||||    .:|.    .:|..:|....::|...
  Fly   247 ET-RAMRCILDRMSSNLLFFLSLHSYGQSIMYPWGY----CRDNPIYWRELSSLANSGKSAIKSY 306

  Fly  1041 TGVKYTVGS-SATTLYPAAGGSDDWAKGIAGIKYAYTIEMGDTGRYGFVLPARFIQYNGKD 1100
            .|.:|..|| |..|....||...|:..|:..:..|..:|: .:...||..|...|...|.:
  Fly   307 NGREYRTGSISCLTKRTIAGSVVDYVYGVLKVPMALVMEL-PSRELGFQPPVEMISQIGHE 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416
M14_CP_A-B_like 821..1112 CDD:199844 96/321 (30%)
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 96/321 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.