DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3108 and Selplg

DIOPT Version :9

Sequence 1:NP_572262.1 Gene:CG3108 / 31506 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:NP_001382082.1 Gene:Selplg / 363930 RGDID:1307971 Length:430 Species:Rattus norvegicus


Alignment Length:255 Identity:68/255 - (26%)
Similarity:91/255 - (35%) Gaps:39/255 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   465 EQHTEA-----EIAPAKIPEEGKPEEEVQVEEESKPVEESKPEEEIKQQEDAKPEEDDQNYAETQ 524
            ||...|     |...|::...|..:.:.:     :|.......|.:.|:. ..|.|.....|.|:
  Rat    86 EQRVSAGAGTSETVTAQVATTGPADPDTE-----RPAVGMLSTESVTQRR-LSPVEMTTRLAPTE 144

  Fly   525 PAVTEVKPEETPADIPVEIPAEV--PAEIPAEIPAEVPAEIPAESPAEIAAEVPAEIPAEIPAEI 587
            ...::..|.|.....|..|.||.  ||.|.||.....|.|.....||      |.|.....||..
  Rat   145 AETSQPAPREAETSQPAPIKAETSQPAPIKAETSQPAPREAETSQPA------PTEAETSQPAPT 203

  Fly   588 PAET--PAETHAEIPADVPAQVVAEAPAETPAETPAEVPAEIPSKVQDEIQSDSTQAEPQVEKEA 650
            .|||  ||.|.||.....|.:|....||.|.|||....|.|..:.     |..||:.|     ..
  Rat   204 KAETSQPAPTEAETSQPAPTEVETSQPAPTEAETSQPAPTEAETS-----QPASTETE-----TT 258

  Fly   651 QQPEKETKPLESSLLTTIIPMVMPQPQVPSQPLQVQDSVLNYVNASFMQQQPSETDLPKT 710
            |.|..:.  :||...|:.:      .:.||......:::....|.|.:...||...||.|
  Rat   259 QLPRSQV--VESLFTTSAV------TEAPSTEPTAMETLSTEANESAIFLGPSIGHLPDT 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416
M14_CP_A-B_like 821..1112 CDD:199844
SelplgNP_001382082.1 rne <95..282 CDD:236766 58/216 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.