DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3108 and AGBL3

DIOPT Version :9

Sequence 1:NP_572262.1 Gene:CG3108 / 31506 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:NP_848658.3 Gene:AGBL3 / 340351 HGNCID:27981 Length:920 Species:Homo sapiens


Alignment Length:450 Identity:84/450 - (18%)
Similarity:144/450 - (32%) Gaps:153/450 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   751 GQLWKEVK-QEVDYLLKPQVLAAAERH----------IRAANLSRIVLIDNLQRVIEKENPPAEK 804
            |.|.|.|| .|.:|.|..:......:|          :||..:.|..:::            ..|
Human   178 GNLQKVVKVAEYEYQLTVRPDLFTNKHTQWYYFQVTNMRAGIVYRFTIVN------------FTK 230

  Fly   805 IAELQNR------------KGHRLTWQ------AYHR----LEDIHGF-------------IDYM 834
            .|.|.:|            |.|.:.||      .|:|    .:..|.|             ..|.
Human   231 PASLYSRGMRPLFYSEKEAKAHHIGWQRIGDQIKYYRNNPGQDGRHYFSLTWTFQFPHNKDTCYF 295

  Fly   835 AKTYP--------------------DICSTEIIGYSVEKRPLKILKIS----NGNAR-NPGIWID 874
            |..||                    ..|...::.:::.:..:.||.|:    |.::| ...:.:.
Human   296 AHCYPYTYTNLQEYLSGINNDPVRSKFCKIRVLCHTLARNMVYILTITTPLKNSDSRKRKAVILT 360

  Fly   875 GGMHARE----WISPATVTYIAN-----QLVEGWEDLPEHMRSINWYIHPVANPDGYEYSHTTDR 930
            ..:|..|    ||....:.||..     ||:..         :..:.:.|:.||||....     
Human   361 ARVHPGETNSSWIMKGFLDYILGNSSDAQLLRD---------TFVFKVVPMLNPDGVIVG----- 411

  Fly   931 LWRKNMRAHGRQCPGVDLNRNFGYKWGGKGTSASPCSQTYRGSKAFSEPETFYISKFISGF--PR 993
                |.|.   ...|.|||||:          .|...:::        |..:|....:...  .|
Human   412 ----NYRC---SLAGRDLNRNY----------TSLLKESF--------PSVWYTRNMVHRLMEKR 451

  Fly   994 ETFQAYLSFHSYG-QYILYPWGYDYQLTQDRA-DLDRVARQAGTSITKSTGVKYTVGSSATTLYP 1056
            |.. .|...|.:. :..::.:|.|   ..||: .|....|.....::|:...|::..:....:..
Human   452 EVI-LYCDLHGHSRKENIFMYGCD---GSDRSKTLYLQQRIFPLMLSKNCPDKFSFSACKFNVQK 512

  Fly  1057 AAGGSDDWAKGIAGIKYAYTIE---MGDT-GRYGFVLPARFIQYNGKD----GVTFADTV 1108
            :..|:........||:.::|:|   .|.| |.      .|...::.||    |..|.|::
Human   513 SKEGTGRVVMWKMGIRNSFTMEATFCGSTLGN------KRGTHFSTKDLESMGYHFCDSL 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416 12/56 (21%)
M14_CP_A-B_like 821..1112 CDD:199844 64/350 (18%)
AGBL3NP_848658.3 M14_AGBL2-3_like 310..570 CDD:133117 56/305 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 641..661
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.