DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3108 and AgaP_AGAP008071

DIOPT Version :9

Sequence 1:NP_572262.1 Gene:CG3108 / 31506 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:XP_555394.3 Gene:AgaP_AGAP008071 / 3291645 VectorBaseID:AGAP008071 Length:364 Species:Anopheles gambiae


Alignment Length:309 Identity:93/309 - (30%)
Similarity:133/309 - (43%) Gaps:45/309 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   838 YPDICSTEIIGYSVEKRPLKILKIS-----------------------------------NGNAR 867
            |||.|..|.||.|.|.|.:..:.|:                                   |.|||
Mosquito    57 YPDKCKVEPIGRSYEGRDINAIYINKQQNKKVFVVANMHALSVEKLGETWLGRDINMMTINYNAR 121

  Fly   868 NPGIWIDGGMHAREWISPATVTYIANQLVEGWEDLPEHMRSINWYIHPVANPDGYEYSHTTDRLW 932
            :. |.:...:|||||.:..|..:|..:||......|| :....|.|.|:|||||||::...||.|
Mosquito   122 DT-IVLVANLHAREWAAMTTALFIIFELVYNGHHHPE-LSQFRWMIVPIANPDGYEFTRERDRYW 184

  Fly   933 RKNMRAH-GRQCPGVDLNRNFGYKWGGKGTSASPCSQTYRGSKAFSEPETFYISKFISGFPRETF 996
            .||.... ..|..|||||.||.|||........|..:||.|.:|.|||||..|||.:.....:..
Mosquito   185 SKNRSPQPDSQTFGVDLNGNFAYKWEENDRPVEPKDRTYNGPQAGSEPETRAISKLLESIGPDIL 249

  Fly   997 QAYLSFHSYGQYILYPWGYDYQLTQDRADLDRVARQAGT-SITKSTGVKYTVGSSATTLYPAAGG 1060
            . ::..|::|.:|.:||.|..: ..:..:|.:....||. :|.......||||:.:.......|.
Mosquito   250 M-FVDMHTFGNHIFHPWSYTTE-PAENVELTKAVAHAGADAIRFKYEEYYTVGTPSQLYRRVYGT 312

  Fly  1061 SDDWAKGIAGIKYAYTIEMGDTGRYGFVLPARFIQYNGKDGVTFADTVA 1109
            ..|:.:.:. |:....:||.::   ||...|..|...|::|.|....:|
Mosquito   313 PIDYCQSLR-IRVCLWLEMTNS---GFQFEASRIMRYGEEGWTAIKAMA 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416
M14_CP_A-B_like 821..1112 CDD:199844 93/309 (30%)
AgaP_AGAP008071XP_555394.3 M14_CP_A-B_like 40..360 CDD:199844 93/309 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.