DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3108 and svr

DIOPT Version :9

Sequence 1:NP_572262.1 Gene:CG3108 / 31506 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:NP_001284744.1 Gene:svr / 30998 FlyBaseID:FBgn0004648 Length:1439 Species:Drosophila melanogaster


Alignment Length:295 Identity:77/295 - (26%)
Similarity:114/295 - (38%) Gaps:61/295 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   818 WQAYHRLEDIHGFIDYMAKTYPDICSTEIIGYSVEKRPLKILKIS-NGNARN---PGIWIDGGMH 878
            :.:..:|||:...::   |.||:......:|.|:|.|.|..|:|| |..:||   |.:.....||
  Fly    40 YASQEQLEDLFAGLE---KAYPNQAKVHFLGRSLEGRNLLALQISRNTRSRNLLTPPVKYIANMH 101

  Fly   879 AREWISPATVTYIANQLVEGWE---DLPEHMRSINWYIHPVANPDGYEYSHTTDRLWRKNMRAHG 940
            ..|.:....:.|:|..|:...|   ||.:.:.|.:.|:.|..|||||..|...:.....|....|
  Fly   102 GDETVGRQLLVYMAQYLLGNHERISDLGQLVNSTDIYLVPTMNPDGYALSQEGNCESLPNYVGRG 166

  Fly   941 RQCPGVDLNRNFGYKWGGKGTSASPCSQTYRGSKAFSEPETFYISKFISGFPRETFQAYLSFHSY 1005
             ....:||||:|..:     ...|...|....|:   :|||..:..:|...|   |....:||..
  Fly   167 -NAANIDLNRDFPDR-----LEQSHVHQLRAQSR---QPETAALVNWIVSKP---FVLSANFHGG 219

  Fly  1006 GQYILYPWGYDYQLTQDRA-------DLDRVARQ-------------AGTSITKSTGVKYTVGSS 1050
            .....||  ||..|..:..       | |||.:|             .|.:...|.....|.|:.
  Fly   220 AVVASYP--YDNSLAHNECCEESLTPD-DRVFKQLAHTYSDNHPIMRKGNNCNDSFSGGITNGAH 281

  Fly  1051 ATTLYPAAGGSDDWAKGIAGIKYAY------TIEM 1079
               .|..:||..|:       .||:      |||:
  Fly   282 ---WYELSGGMQDF-------NYAFSNCFELTIEL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416
M14_CP_A-B_like 821..1112 CDD:199844 77/292 (26%)
svrNP_001284744.1 M14_CPD_I 40..334 CDD:199850 77/295 (26%)
Peptidase_M14NE-CP-C_like 338..416 CDD:200604
M14_CP_N-E_like 456..759 CDD:199842
Peptidase_M14NE-CP-C_like 763..839 CDD:200604
CarbopepD_reg_2 1125..1202 CDD:290434
CarboxypepD_reg 1223..1301 CDD:290350
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.