DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3108 and CG33299

DIOPT Version :9

Sequence 1:NP_572262.1 Gene:CG3108 / 31506 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:NP_995671.2 Gene:CG33299 / 2768912 FlyBaseID:FBgn0053299 Length:193 Species:Drosophila melanogaster


Alignment Length:99 Identity:28/99 - (28%)
Similarity:39/99 - (39%) Gaps:6/99 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   534 ETPADIPVEIPAEVPAEIPAEIPAEVPAEIPAESPAEIAAEVPAEIPAEIPAEIPAETPAETHAE 598
            |....:||.:..:||..||..:..:||..|..:.|...|..||  :..||...:....|..|..:
  Fly    81 EISKHVPVHVIEKVPLPIPHPVAVQVPNVIRLQIPEPYAVHVP--VQQEIHVPVYKIVPEITEKK 143

  Fly   599 IPADV----PAQVVAEAPAETPAETPAEVPAEIP 628
            ||..|    |.:|....|.|...:....||...|
  Fly   144 IPYTVEKPYPVEVEKPYPVEVIKQIKIPVPKPYP 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416
M14_CP_A-B_like 821..1112 CDD:199844
CG33299NP_995671.2 predic_Ig_block 123..>184 CDD:275319 15/57 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.