DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3108 and Agbl5

DIOPT Version :9

Sequence 1:NP_572262.1 Gene:CG3108 / 31506 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:XP_036020907.1 Gene:Agbl5 / 231093 MGIID:2441745 Length:1007 Species:Mus musculus


Alignment Length:145 Identity:32/145 - (22%)
Similarity:64/145 - (44%) Gaps:28/145 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 IQPEQVQPGEYQSESDG---EQAETKPEIEAQP------------EVEAQPEAEAQPEAEPQLEV 281
            :.|:.|..|.|:::|.|   .:...||:....|            .|.::..|::....:|.|.:
Mouse   413 LNPDGVVRGHYRTDSRGVNLNRQYLKPDAVLHPAIYGAKAVLLYHHVHSRLNAKSPTNQQPTLHL 477

  Fly   282 EPQ---PEVESQPEVESQPEVEAQPEVE-PQSEVESQPEAESHSEPETQAEVEAQPEVESLPEAE 342
            .|:   .::|....:.::..:...|:.| |.:..|::| ||..::|     |...|  :.:||.|
Mouse   478 PPEAPLSDLEKANNLHNEAHLGQSPDGENPATWPETEP-AEEKTDP-----VWLMP--QPIPELE 534

  Fly   343 SQPEAESQPEREPEV 357
             :|..::.|.:|..|
Mouse   535 -EPAPDTIPPKESGV 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416
M14_CP_A-B_like 821..1112 CDD:199844
Agbl5XP_036020907.1 Pepdidase_M14_N 102..>214 CDD:407865
M14_AGBL5_like 304..695 CDD:349455 32/145 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.