DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3108 and W01A8.6

DIOPT Version :9

Sequence 1:NP_572262.1 Gene:CG3108 / 31506 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:NP_492003.2 Gene:W01A8.6 / 189076 WormBaseID:WBGene00012168 Length:380 Species:Caenorhabditis elegans


Alignment Length:290 Identity:96/290 - (33%)
Similarity:139/290 - (47%) Gaps:39/290 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   821 YHRLEDIHGFIDYMAKTYPDICSTEIIGYSVEKRPLKILKISNGNARNPG-----IWIDGGMHAR 880
            |:.......:|..:|...|.....:.||.:.|.|||  |.:..|....||     :|:|||.|||
 Worm    35 YNDWPQFEDYIKGVAHDNPSFVQLKTIGRTREGRPL--LGVRIGKPALPGKRKIAVWLDGGNHAR 97

  Fly   881 EWISPATVTYIANQLVEGW---EDLPEHMRSINWYIHPVANPDGYEYSHTTDRL----WRKNMRA 938
            ||.:.....|...:||.|:   :.:.:::.:::.|:.||.||||:.||.|:.|.    ||||...
 Worm    98 EWPAFHVAVYFIEKLVNGYLSDDKITKYVETLDIYVFPVLNPDGFVYSRTSTRAMIRQWRKNRAP 162

  Fly   939 HGRQ----------CPGVDLNRNFGYKWGGKG-TSASPCSQTYRGSKAFSEPET-----FYISKF 987
            ....          |.|||||||:...:..|. ...:|||..::|.:.||||||     |.:|..
 Worm   163 ENCTGTGPFQTDICCEGVDLNRNYDIGFSHKNYPFNNPCSDEFQGPRPFSEPETRAVRDFIMSSE 227

  Fly   988 ISGFPRETFQAYLSFHSYGQYILYPWGYDYQ---LTQDRADLDRVARQAGTSITKSTGVKYTVGS 1049
            |.|    ...|.:|.|::||..:.|  |:||   ..||..||:.:|.:|...:......||.||:
 Worm   228 IYG----RLYALVSMHTHGQLWILP--YNYQKRTYPQDIKDLEILANRAADRVFAYRETKYRVGT 286

  Fly  1050 SATTLYPAAGGSDDWAKGIAGIKYAYTIEM 1079
            :|..|..|.||:.||.|.....||.|.:|:
 Worm   287 AADMLGTATGGATDWIKKNTPTKYVYVLEL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416
M14_CP_A-B_like 821..1112 CDD:199844 96/290 (33%)
W01A8.6NP_492003.2 Zn_pept 35..337 CDD:214748 96/290 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100142
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.