DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3108 and ccpp-6

DIOPT Version :9

Sequence 1:NP_572262.1 Gene:CG3108 / 31506 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:NP_495012.2 Gene:ccpp-6 / 184043 WormBaseID:WBGene00017136 Length:459 Species:Caenorhabditis elegans


Alignment Length:339 Identity:59/339 - (17%)
Similarity:116/339 - (34%) Gaps:141/339 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   807 ELQNRKGHRLTWQAYHRLEDIHGFIDYMAKTYPDICSTEIIGYSVEKRPLKILKIS------NGN 865
            ||::||     :..:||        |.:.:|             |:||.:.::.|.      .|:
 Worm   155 ELESRK-----YPFFHR--------DLLVQT-------------VQKRRVDLITIDATPDTFQGS 193

  Fly   866 ARNPGIWIDGGMHAREWISPATVTYIANQLVE---GWEDLPEHMRSINWY-IHPVANPDGYEYSH 926
            .:.  |::...:|..|  ||:  :::.:.::|   ..:|..:.:|.:..: |.|:.||||....:
 Worm   194 KKM--IFLTARVHPGE--SPS--SHVMHGIIEFLVSKDDRAQKLRKVYCFKIIPMLNPDGVFLGN 252

  Fly   927 TTDRLWRKNMRAHGRQCPGVDLNRNFGYKWGGKGTSASPCSQTYRGSKAFSEPETFYISKFISGF 991
                 :|.::..|       ||||                  .:|....::.|..:.:...::.:
 Worm   253 -----YRCSLMGH-------DLNR------------------MWRTPSDWAHPSIYAVKNLLTQY 287

  Fly   992 ---PRETFQAYLSFHSYGQ---------------------------YILYPWGYDYQL--TQDRA 1024
               |:.....|:..|::.|                           ::|.....||.|  ||...
 Worm   288 DNNPQAQTVIYVDLHAHSQKPNCFLYGNVNMSAVEEKSTFRQLWLPHLLADLSEDYSLEFTQFNT 352

  Fly  1025 DLDRVARQAGTSITKSTGVKYTVGSSATTLYPAAGGSDDWAKGIAGIKYAYTIEMG-------DT 1082
            |:::    |||.       :.|:|...:.|                   .||:|:.       |:
 Worm   353 DVEK----AGTG-------RRTMGDLLSCL-------------------CYTLEVSFFSYRHTDS 387

  Fly  1083 GRYGFVLPARFIQY 1096
            ...|......::||
 Worm   388 SGNGIQHCTPYLQY 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416
M14_CP_A-B_like 821..1112 CDD:199844 55/325 (17%)
ccpp-6NP_495012.2 M14_AGBL4_like 153..418 CDD:133118 59/339 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.