DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3108 and cpd-2

DIOPT Version :9

Sequence 1:NP_572262.1 Gene:CG3108 / 31506 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:NP_510625.2 Gene:cpd-2 / 181684 WormBaseID:WBGene00012073 Length:492 Species:Caenorhabditis elegans


Alignment Length:282 Identity:63/282 - (22%)
Similarity:100/282 - (35%) Gaps:69/282 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   821 YHRLED-IHGFIDYMAKTYPDICSTEIIGYSVEKRPLKILKISNGNARN----PGIWIDGGMHAR 880
            |..|.| ||.    :.:.:|::......|.||:.|.|.:|.:|.....:    |.......||..
 Worm    61 YSTLTDHIHN----LHRKFPNLTHIYSAGQSVQGRELWVLVVSRYPIEHRKLIPEFKYVANMHGN 121

  Fly   881 EWISPATVTYIANQLVEGWED---LPEHMRSINWYIHPVANPDGYEYSHTTDRLWRKNMRAHGRQ 942
            |......:..:|:.|:|.:..   :.:.:.|...::.|..||||||::...|:     ....|||
 Worm   122 EVTGRVFLVSLAHTLLENYNSNLWIRQLVDSTRIHLMPSMNPDGYEHASEGDQ-----AGVTGRQ 181

  Fly   943 -CPGVDLNRNFGYKWGGKGTSASPCSQTYRGSKAFSEPETFYISKFISGFPRETFQAYLSFHSYG 1006
             ..|.||||||..::    .:..|.|:.        :|||..|..:....|   |....:.|...
 Worm   182 NANGKDLNRNFPSRF----PNYFPTSEI--------QPETIAIMNWTRQIP---FALSANLHGGT 231

  Fly  1007 QYILYPWGYD----------YQLTQDRADLDRVA-------------------RQAGTSITKSTG 1042
            ..:.||  :|          |..:.|.|...|:|                   .....|:....|
 Worm   232 TLVNYP--FDDFPTRTRQSHYAPSPDNALFVRLAYTYARGHERMWKKGPRCLDDDLNISVDPQNG 294

  Fly  1043 VKYTVGSSATTLYPAAGGSDDW 1064
            :     .:....|..:||..||
 Worm   295 I-----INGADWYIVSGGMQDW 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416
M14_CP_A-B_like 821..1112 CDD:199844 63/282 (22%)
cpd-2NP_510625.2 M14_CP_N-E_like 58..352 CDD:349431 63/282 (22%)
Peptidase_M14NE-CP-C_like 358..433 CDD:200604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.