DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3108 and CPA3

DIOPT Version :9

Sequence 1:NP_572262.1 Gene:CG3108 / 31506 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:NP_001861.2 Gene:CPA3 / 1359 HGNCID:2298 Length:417 Species:Homo sapiens


Alignment Length:409 Identity:132/409 - (32%)
Similarity:206/409 - (50%) Gaps:34/409 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   722 RYDGAQVWRIVVQTDKDKRMADELQSKYDGQLW-------KEVKQEVDYLLKPQVLAAAERHIRA 779
            |:|..:|:|:..|.:|...:..:|....:...|       ......||:.:..:...|.:..:..
Human    20 RFDREKVFRVKPQDEKQADIIKDLAKTNELDFWYPGATHHVAANMMVDFRVSEKESQAIQSALDQ 84

  Fly   780 ANLSRIVLIDNLQRVIEKENPPAEKIAELQNRKGHRLTWQAYHRLEDIHGFIDYMAKTYPDICST 844
            ..:...:||.:||..|||:....|.|.       .|.::..|:..|.|..:.:.|...||::.|.
Human    85 NKMHYEILIHDLQEEIEKQFDVKEDIP-------GRHSYAKYNNWEKIVAWTEKMMDKYPEMVSR 142

  Fly   845 EIIGYSVEKRPLKILKISNGNARNPGIWIDGGMHAREWISP---------ATVTYIANQLVEGWE 900
            ..||.:||..||.:|||...|.|...|:.|.|:|||||:||         ||.||..|::     
Human   143 IKIGSTVEDNPLYVLKIGEKNERRKAIFTDCGIHAREWVSPAFCQWFVYQATKTYGRNKI----- 202

  Fly   901 DLPEHMRSINWYIHPVANPDGYEYSHTTDRLWRKN-MRAHGRQCPGVDLNRNFGYKWGGKGTSAS 964
             :.:.:..:|:||.||.|.|||.:|.|.:|:|||| .:....:|.|.||||||...|.....:..
Human   203 -MTKLLDRMNFYILPVFNVDGYIWSWTKNRMWRKNRSKNQNSKCIGTDLNRNFNASWNSIPNTND 266

  Fly   965 PCSQTYRGSKAFSEPETFYISKFISGFPRETFQAYLSFHSYGQYILYPWGYDYQLTQDRADLDRV 1029
            ||:..||||...||.||..::.||.....| .:.|::||||.|.:|:|:||..:|..:..||.:|
Human   267 PCADNYRGSAPESEKETKAVTNFIRSHLNE-IKVYITFHSYSQMLLFPYGYTSKLPPNHEDLAKV 330

  Fly  1030 ARQAGTSITKST-GVKYTVGSSATTLYPAAGGSDDWAKGIAGIKYAYTIEMGDTGRYGFVLPARF 1093
            |: .||.:..:. ..:|..|...:|:||.:|.|.|||..: |||:.:..|:.|.|::||:||...
Human   331 AK-IGTDVLSTRYETRYIYGPIESTIYPISGSSLDWAYDL-GIKHTFAFELRDKGKFGFLLPESR 393

  Fly  1094 IQYNGKDGVTFADTVARAI 1112
            |:...::.:.....:|:.|
Human   394 IKPTCRETMLAVKFIAKYI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416 13/73 (18%)
M14_CP_A-B_like 821..1112 CDD:199844 110/301 (37%)
CPA3NP_001861.2 Propep_M14 28..102 CDD:280416 13/73 (18%)
M14_CPB 114..413 CDD:199852 111/308 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157607
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 1 1.000 - - mtm9821
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1730
SonicParanoid 1 1.000 - - X86
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.780

Return to query results.
Submit another query.