DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3108 and AgaP_AGAP008371

DIOPT Version :9

Sequence 1:NP_572262.1 Gene:CG3108 / 31506 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:XP_317082.4 Gene:AgaP_AGAP008371 / 1277611 VectorBaseID:AGAP008371 Length:165 Species:Anopheles gambiae


Alignment Length:142 Identity:50/142 - (35%)
Similarity:68/142 - (47%) Gaps:2/142 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   960 GTSASPCSQTYRGSKAFSEPETFYISKFISGFPRETFQAYLSFHSYGQYILYPWGY-DYQLTQDR 1023
            |.|...|:..|.|....||.||..:.::..... :..:.:|.|||||||||.|:|| |.....:.
Mosquito     4 GASQVACNDIYAGPSPASEVETRNMMEYYETIV-DRIELHLQFHSYGQYILLPYGYQDADYPDNY 67

  Fly  1024 ADLDRVARQAGTSITKSTGVKYTVGSSATTLYPAAGGSDDWAKGIAGIKYAYTIEMGDTGRYGFV 1088
            :|...:|..|....:|.....||.|:.|..||..:|.:.|||.|......:...|..|.|.||||
Mosquito    68 SDQLEIAEAAAIGFSKRYNTPYTYGTIADVLYVDSGSTTDWAHGYHKTPLSMCFEFRDNGAYGFV 132

  Fly  1089 LPARFIQYNGKD 1100
            |||..|..|.::
Mosquito   133 LPADQIIPNAEE 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416
M14_CP_A-B_like 821..1112 CDD:199844 50/142 (35%)
AgaP_AGAP008371XP_317082.4 Peptidase_M14_like <1..156 CDD:299699 50/142 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X86
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.