DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3108 and AgaP_AGAP007530

DIOPT Version :9

Sequence 1:NP_572262.1 Gene:CG3108 / 31506 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:XP_308351.4 Gene:AgaP_AGAP007530 / 1269705 VectorBaseID:AGAP007530 Length:1090 Species:Anopheles gambiae


Alignment Length:447 Identity:80/447 - (17%)
Similarity:132/447 - (29%) Gaps:165/447 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 NMKLTSIPSA---DSSDMYMLVPDTVASQLEDTEHVNRNSIEADPES--------DPSG------ 113
            :.|..|:|:.   :|.::..|.|.....:|...|.|:|.|.|:..|:        .|.|      
Mosquito   273 SQKYDSLPATAAEESKNISNLAPHRRKGKLSKMERVDRTSPESFDETARDGVGEGSPPGKEVLAE 337

  Fly   114 -----------SSSSDMLMLESDSSPAMQLVELPSDITVAESQPETEHDTENDQQQPESIEEHVV 167
                       ..:..|::.|:.|....|:..|.:.:.:  ..|:...:.:...||..| ....:
Mosquito   338 AAKSLQTVLGPGGAGGMVIDENTSESMQQITNLVNKVKI--ELPQGGSEMKQPAQQASS-SASAM 399

  Fly   168 LMKPASQEAQLEQTVDLATEAAPVPLNDEL--PEDE---------------ESPAATESAVEELE 215
            ..|..|...||......|..|.|.|.:|:.  |.||               .....|.|:...::
Mosquito   400 KAKLPSFHHQLNVASAAAVAANPSPEDDQKADPRDEIYYCRELLTHSIEHRRIELLTISSFHGIQ 464

  Fly   216 KESEAAMDDQVPEESE------------------------------------------------- 231
            ...|..:.:..|:|:.                                                 
Mosquito   465 TARETRLRNLFPDEAAQRCHTFREKKIVFISSRVHPGETPASFVLNGFLSMLLDRKSIVSQTLRR 529

  Fly   232 ---------IQPEQVQPGEYQSESDG---EQAETKPEIEAQPEVEAQPEAEAQPEAEPQLEVEPQ 284
                     :.|:.|..|.|:|::.|   .:....|..|.||.:.|     |:.||         
Mosquito   530 MYVFKIIPFLNPDGVYNGLYRSDTRGHNLNRVYISPCHETQPAIYA-----ARNEA--------- 580

  Fly   285 PEVESQPEVESQPEVEAQPEVEPQSEVESQPEAESHSEPETQAEVEAQPEVESLPEAESQPEAES 349
                      |........:|...:.:.:|..|:|...|               |.|:|.|.|..
Mosquito   581 ----------SSTSSSLTSKVASSTALPTQSSADSTGSP---------------PTADSTPPAVV 620

  Fly   350 QPE-------REPEVEAEK--------ISDNEVDTTEAS--LMETLVEGIEDGLTAA 389
            ||:       ...:|..||        :|:..|.|..:|  |....|.|...|.:|:
Mosquito   621 QPQSLVAAATTAAQVFTEKLIPELNPIVSEGTVPTASSSNNLAPATVRGTAGGRSAS 677

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416
M14_CP_A-B_like 821..1112 CDD:199844
AgaP_AGAP007530XP_308351.4 Peptidase_M14_like 432..>577 CDD:299699 19/149 (13%)
Peptidase_M14_like <888..1039 CDD:299699
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.