DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3108 and AgaP_AGAP012947

DIOPT Version :9

Sequence 1:NP_572262.1 Gene:CG3108 / 31506 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:XP_003436089.1 Gene:AgaP_AGAP012947 / 11175807 VectorBaseID:AGAP012947 Length:472 Species:Anopheles gambiae


Alignment Length:444 Identity:80/444 - (18%)
Similarity:141/444 - (31%) Gaps:90/444 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 AQPEAEPQLEVEPQPEVESQPEVESQPEVEAQPEVEPQSEVESQPEAESHSEPETQAEVEAQPEV 335
            |:|::.|......:|:....||.:...:.|.|.:.:.|.:.:.|.|:..::|....|....|...
Mosquito    73 ARPQSAPNKHYHYRPQYRPAPEPDQYDDNEEQDQQDQQDQEQQQQESSDYAEDSATAGATHQYMT 137

  Fly   336 ESLPEAESQPEAESQPEREPEVEAEKISDNEVDTTEASLMETLVEGIEDGLTAAMDNLVPEELAE 400
            ......:.......:|...   ::|:..|.:...:|.|.........:               .:
Mosquito   138 TYKTSTKHGGGTRYRPSYS---DSEEEDDEDTCASEESNAYNAYRAYQ---------------GK 184

  Fly   401 ASDKQETELESEDQQSPVTEA-------IEEQAVPEIEQEKEKEPEQITLADETEQDSAQPSNEE 458
            .|.|.:|...|....|....:       ::.|..|:.:::.:::.:|.......:|...|.|...
Mosquito   185 GSKKPQTHHASSSAASSGLGSNRYHQHYVQHQHRPKHQEQHQQQQQQHHHHHHRQQQQQQSSYHH 249

  Fly   459 PVEIAPEQHT--EAEIAPAKIPEEGKPEEEVQVEEESKPVEESKPEEEIKQQEDAKPEED----- 516
              ...|..||  ..::..|.....|.|.:        .|......::|...:|..:.:||     
Mosquito   250 --HHVPSAHTSYHPQLIQAYKILHGTPNQ--------LPTSHEYTDDEDGSEEFDEEDEDFHSGA 304

  Fly   517 --------DQNYAETQPAVTEV---KPEETPADIPVEIPAEVPAEIPAEIPAEVPAEIPAESPAE 570
                    ...|..|..|..::   |....|....|||...||.....:|...:|.|:..:.|..
Mosquito   305 AIGAAAGLTSGYGATGSAAHQIIHTKGRAVPISQHVEIETPVPVPYVKKIHVPIPQEVRIKIPHP 369

  Fly   571 IAAEVPAEIPAEIPAEIPAETPAETHAEIPAD----VPAQVVAEAPAETPAETPAE--VPAEIPS 629
            :...||...|..||...|...|......:|.:    .|.:.....|.|.|...|.|  ||..:|.
Mosquito   370 VLVPVPRPYPVHIPVAQPIAVPDIKEITVPIEKIVPYPVEKKIPVPIEKPVPYPVEKHVPVYLPH 434

  Fly   630 KVQDEIQSDSTQAEPQVEKEAQQPEKETKPLESSLLTTIIPMVMPQ----PQVP 679
            .:                           |::..::.|||..|..|    |.:|
Mosquito   435 PI---------------------------PVKVPIVKTIIHKVKQQTASGPPLP 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416
M14_CP_A-B_like 821..1112 CDD:199844
AgaP_AGAP012947XP_003436089.1 predic_Ig_block 371..>456 CDD:275319 23/111 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.