DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3108 and asb4

DIOPT Version :9

Sequence 1:NP_572262.1 Gene:CG3108 / 31506 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:XP_002940682.2 Gene:asb4 / 100496646 XenbaseID:XB-GENE-493274 Length:427 Species:Xenopus tropicalis


Alignment Length:181 Identity:35/181 - (19%)
Similarity:57/181 - (31%) Gaps:57/181 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   858 ILKISNGN----ARNPGIWIDGGMHAREWISPATVTYIANQLVEGWEDLPEHMRSINWYIHPVAN 918
            :.::.:.|    |..||.|:........|.:...:|.:... ||....|.:|..|:|      :.
 Frog    48 VFEVEDENLVLAAYKPGYWLPSYKLTSSWATGLHITVMLGH-VESLLVLLQHRASVN------SR 105

  Fly   919 PDGYEYSHTTDRLWR----KNMRAHGR----------------------QCP------GVDLNRN 951
            |:|....|....:..    |.:.:||.                      :|.      |.|:|..
 Frog   106 PNGKSPLHVACEIANLDCVKVLISHGAKLNSFSVSGLAPLHYCTTKESIKCAKELVWNGADINLQ 170

  Fly   952 FGYKWGGKGTSASPCSQTYRGSKAFSEPE--TFYISKFISGFPRETFQAYL 1000
                 |...|..:|.....|    ...||  .||::   .|...::..|||
 Frog   171 -----GNGETEETPLHTACR----IGIPELVAFYVN---HGAVVDSVNAYL 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416
M14_CP_A-B_like 821..1112 CDD:199844 35/181 (19%)
asb4XP_002940682.2 PHA02876 <24..>317 CDD:165207 35/181 (19%)
ANK repeat 78..105 CDD:293786 7/33 (21%)
Ank_2 80..170 CDD:403870 17/96 (18%)
ANK repeat 107..138 CDD:293786 5/30 (17%)
ANK repeat 140..170 CDD:293786 4/29 (14%)
ANK repeat 173..206 CDD:293786 8/39 (21%)
ANK repeat 208..250 CDD:293786 2/2 (100%)
ANK repeat 252..283 CDD:293786
SOCS_ASB4_ASB18 380..427 CDD:239693
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165175513
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.