DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3108 and lman1

DIOPT Version :9

Sequence 1:NP_572262.1 Gene:CG3108 / 31506 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:NP_001234922.2 Gene:lman1 / 100494337 XenbaseID:XB-GENE-492680 Length:511 Species:Xenopus tropicalis


Alignment Length:167 Identity:35/167 - (20%)
Similarity:60/167 - (35%) Gaps:25/167 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 QPEAEAQPEAEPQLEVEPQPEVESQPEVESQPEVEAQPEVEPQSEVESQPEAESHSEPETQAEVE 330
            :|..||.|   |..|:..:.:.:.|.|.::.           |.|::.:.|......||. ||..
 Frog   267 EPGKEAPP---PDTEIPKEEKDKYQEEFDNF-----------QQELDKRKEEFQKDHPEA-AEQP 316

  Fly   331 AQPEVESLPEAESQPEAESQPEREPEV-----EAEKISDNEVDTTEASLMETLVEGIEDGLTAA- 389
            .....||:.:.|.:...|.|.....|:     :.:.|.|.:.....|...|....|..||.... 
 Frog   317 VDDMYESVNDRELRQIFEGQNRIHLEIKQLNRQLDMILDEQRRYVTAVTDEIAKRGAGDGAGTGG 381

  Fly   390 ---MDNLVPEELA-EASDKQETELESEDQQSPVTEAI 422
               .....|.:|. ..|.::|...:..|.:|.::|.:
 Frog   382 PGHQQQFAPADLQFLLSTQREVLQQMADMRSSISETV 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416
M14_CP_A-B_like 821..1112 CDD:199844
lman1NP_001234922.2 lectin_ERGIC-53_ERGL 42..266 CDD:173890
Cytochrom_B562 <270..320 CDD:294917 14/64 (22%)
OmpH <281..371 CDD:281871 19/101 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.