DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3108 and cpo

DIOPT Version :9

Sequence 1:NP_572262.1 Gene:CG3108 / 31506 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:NP_001139101.1 Gene:cpo / 100005630 ZFINID:ZDB-GENE-070619-6 Length:363 Species:Danio rerio


Alignment Length:292 Identity:110/292 - (37%)
Similarity:163/292 - (55%) Gaps:16/292 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   821 YHRLEDIHGFIDYMAKTYPDICSTEIIGYSVEKRPLKILKIS-NGNARNPGIWIDGGMHAREWIS 884
            ||.:::|..:::.|.:..||:.||...|.:.|||.:.:|||. :.......||:|.|:||||||:
Zfish    35 YHTMDEISAWMNQMQRENPDVVSTMTYGQTYEKRNITLLKIGFSSTTPKKAIWMDCGIHAREWIA 99

  Fly   885 PATVTYIANQLVEGWE-DLPEHM--RSINWYIHPVANPDGYEYS--HTTDRLWRKNMRA--HGRQ 942
            ||...:...:::..:: |...:|  :::::||.||.|.|||.||  :.:.|||||:...  ....
Zfish   100 PAFCQHFVKEVLGSYKTDSRVNMLFKNLDFYITPVLNMDGYIYSWLNNSTRLWRKSRSPCHENST 164

  Fly   943 CPGVDLNRNFGYKWGGKGTSASPCSQTYRGSKAFSEPETFYISKFISGFPRETFQAYLSFHSYGQ 1007
            |.|.||||||...||..|.|.:.||:.|.|:.|.||||...::.|: |..:.....||:.|||||
Zfish   165 CSGTDLNRNFYANWGMVGISRNCCSEVYNGATALSEPEAEAVTDFL-GAHQNHLLCYLTIHSYGQ 228

  Fly  1008 YILYPWGYDYQLTQDRADLDRVARQAGTSITKSTGVKYTVGSSATTLYPAAGGSDDWAKGIAGIK 1072
            .||.|:|:......:..:|..|...|..:|....|..|.||||...|||.:|.|.|:|: :.||.
Zfish   229 LILVPYGHPNISAPNYDELMEVGLAAAKAIKAVHGKSYKVGSSPDVLYPNSGSSRDFAR-LIGIP 292

  Fly  1073 YAYTIEMGDTGRYGFVLPARFIQ------YNG 1098
            |::|.|:.|.|::||:||...||      |.|
Zfish   293 YSFTFELRDEGQHGFILPEDQIQPTCQEAYEG 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416
M14_CP_A-B_like 821..1112 CDD:199844 110/292 (38%)
cpoNP_001139101.1 M14_CP_A-B_like 35..332 CDD:199844 110/292 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593409
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1730
SonicParanoid 1 1.000 - - X86
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.880

Return to query results.
Submit another query.