DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42264 and AGBL4

DIOPT Version :9

Sequence 1:NP_572260.2 Gene:CG42264 / 31504 FlyBaseID:FBgn0259149 Length:634 Species:Drosophila melanogaster
Sequence 2:XP_011540610.1 Gene:AGBL4 / 84871 HGNCID:25892 Length:531 Species:Homo sapiens


Alignment Length:403 Identity:61/403 - (15%)
Similarity:130/403 - (32%) Gaps:136/403 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 VWNINQDGIDILIEQRNVADARKFMDKVGYSYNIMIDDIESAIDESYVEVPAVEHPLDSVRNNSL 313
            ||      .:..:|....:..|:.:|    ::.:::..|.:.::.|..:....:.....|::.|.
Human    81 VW------FNFTVENVKESQVREIVD----TFRVVLRVIFNIVNFSKTKSLYRDGMAPMVKSTSR 135

  Fly   314 P-WMEVPGSTMNWRRYHD---------------QADIKQFLQTLLETYS-----------ENVEL 351
            | |..:|...:.:.|..|               :.||.||......||:           .|::.
Human   136 PKWQRLPPKNVYYYRCPDHRKNYVMSFAFCFDREEDIYQFAYCYPYTYTRFQHYLDSLQKRNMDY 200

  Fly   352 I---QIGVTRNKRPLEVIRVSNGNPDN----------------------------------WAVF 379
            .   |:|.:..:|.|:::.::  :|||                                  ||..
Human   201 FFREQLGQSVQQRKLDLLTIT--SPDNLREGAEQKVVFITGRVHPGETPSSFVCQGIPPGHWAAL 263

  Fly   380 VDA-----GLQARDWLSPAALTYAISKLTHLWGRPKGKDKGEGQRQSRAEKAMRR-IDWYFLPLA 438
            ..:     |:.   |:||..:.:.:|                   |......:|. :.:...|:.
Human   264 SSSFQNSPGIH---WMSPGIIDFLVS-------------------QHPIACVLREYLVFKIAPML 306

  Fly   439 NPDGYQYSRQTDRLWTKNRGYDSVSGCYGVNLDRNFDYGWDGTGSTSNPCKNLYRGAHSFSEPES 503
            ||||.........|             .|.:|:|:    |      .:|...::...|...:   
Human   307 NPDGVYLGNYRCSL-------------MGFDLNRH----W------LDPSPWVHPTLHGVKQ--- 345

  Fly   504 RAVCSFLSGMREYLGAYVSLGGYGQAIT-YPWGDADYVTENQRNLKQTARRAVLALRRLNQAEYS 567
             .:....:..:..|..|:.:..:...:. :.:|:   :.|::...::.|....|..:......||
Human   346 -LIVQMYNDPKTSLEFYIDIHAHSTMMNGFMYGN---IFEDEERFQRQAIFPKLLCQNAEDFSYS 406

  Fly   568 SGTSYRQKLARPG 580
            | ||:.:...:.|
Human   407 S-TSFNRDAVKAG 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42264NP_572260.2 Propep_M14 <241..293 CDD:280416 6/43 (14%)
M14_CP_A-B_like 328..633 CDD:199844 48/323 (15%)
AGBL4XP_011540610.1 M14_AGBL4_like 190..475 CDD:133118 41/284 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.