DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42264 and AT5G42320

DIOPT Version :9

Sequence 1:NP_572260.2 Gene:CG42264 / 31504 FlyBaseID:FBgn0259149 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_001332683.1 Gene:AT5G42320 / 834237 AraportID:AT5G42320 Length:430 Species:Arabidopsis thaliana


Alignment Length:292 Identity:59/292 - (20%)
Similarity:117/292 - (40%) Gaps:47/292 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 MNWRRYHDQADIKQFLQTLLETYSE--NVELIQIGVTRNKRPLEVIRVSNGNPD-----NWAVFV 380
            :||..||...|:.:.:.:|:..:.:  ::|||:.|.......:.|:....|..:     |:.:.:
plant    40 INWDLYHSSDDLMEQIHSLVHRHPDKLSIELIKSGNKGYNAEVNVVTYCRGGKESDDRSNFRILL 104

  Fly   381 DAGLQARDWLSPAALTYAISKLTHLWGRPKGKDKGEGQRQSRAEKAMRRIDWYFLPLANPDGYQY 445
            ..|...|:.::.......:|.|:.....|   :|..|..::..:|.:.::    :|:.||:|.:.
plant   105 TFGQHGRELITSELAFRILSILSEEQFLP---NKNGGILKNTLDKLVIKM----VPIENPNGRKR 162

  Fly   446 SRQTDRLWTKNRGYDSVSGCYGVNLDRNFDYGW-----DGTGSTSNPCKNLYRGAHSFSEPESRA 505
            ....| |..:..|       .||:|:||:...|     |...|..||      |...|||||::.
plant   163 VESGD-LCERRNG-------RGVDLNRNWGVDWGKKEKDYDPSEENP------GTAPFSEPETQI 213

  Fly   506 VCSFLSGMREYLGAYVSLGGYGQAITYPWGDADYVTENQRNLKQTARRAVLALRRLN------QA 564
            :.........::  ::::....:|:..|:...:...|...:.|...     .|.:||      :.
plant   214 MRKLAISFDPHI--WINVHSGMEALFMPYDHKNITPEGLPSQKMRT-----LLEKLNKFHCHDRC 271

  Fly   565 EYSSGTSYRQKLARPGNSADWVQDRIGPQLVF 596
            ...||......||. |.:.|::.|.:...:.|
plant   272 MIGSGGGSVGYLAH-GTATDYIYDVVKAPMAF 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42264NP_572260.2 Propep_M14 <241..293 CDD:280416
M14_CP_A-B_like 328..633 CDD:199844 57/287 (20%)
AT5G42320NP_001332683.1 M14-CPA-like 100..321 CDD:349446 46/232 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D524270at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.