DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42264 and Agbl4

DIOPT Version :9

Sequence 1:	NP_572260.2	Gene:	CG42264 / 31504	FlyBaseID:	FBgn0259149	Length:	634	Species:	Drosophila melanogaster
Sequence 2:	XP_011238954.1	Gene:	Agbl4 / 78933	MGIID:	1918244	Length:	552	Species:	Mus musculus

Alignment Length:	177	Identity:	31/177 - (17%)
Similarity:	62/177 - (35%)	Gaps:	63/177 - (35%)

- Green bases have known domain annotations that are detailed below.

  Fly   308 VRNNSLP-WMEVPGSTMNWRRYHD---------------QADIKQFLQTLLETYS---------- 346
            |::.|.| |..:|...:.:.|..|               :.||.||......||:
Mouse   130 VKSTSRPKWQRLPPKNVYYYRCPDHRKNYVMSFAFCFDREDDIYQFAYCYPYTYTRFQHYLDSLQ 194

  Fly   347 -ENVELI---QIGVTRNKRPLEVIRVSNGNPDNW-------AVF----VDAGLQARDWLSPAALT 396
             :|::..   |:|.:..:|.|:::.::  :|:|.       .:|    |..|.....::....:.
Mouse   195 KKNMDYFFREQLGQSVQQRQLDLLTIT--SPENLREGSEKKVIFITGRVHPGETPSSFVCQGIID 257

  Fly   397 YAISKLTHLWGRPKGKDKGEGQRQSRAEKAMR-RIDWYFLPLANPDG 442
            :.:|                   |....:.:| .:.:...|:.||||
Mouse   258 FLVS-------------------QHPIARVLREHLVFKIAPMLNPDG 285

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42264	NP_572260.2	Propep_M14	<241..293	CDD:280416
CG42264	NP_572260.2	M14_CP_A-B_like	328..633	CDD:199844	25/156 (16%)
Agbl4	XP_011238954.1	Pepdidase_M14_N	65..>142	CDD:375499	4/11 (36%)
Agbl4	XP_011238954.1	M14_AGBL4_like	199..450	CDD:349479	17/108 (16%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG2866
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900