DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42264 and Agbl3

DIOPT Version :9

Sequence 1:NP_572260.2 Gene:CG42264 / 31504 FlyBaseID:FBgn0259149 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_001276585.1 Gene:Agbl3 / 76223 MGIID:1923473 Length:1006 Species:Mus musculus


Alignment Length:180 Identity:41/180 - (22%)
Similarity:58/180 - (32%) Gaps:52/180 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   428 RRIDWYFLPLANPDGYQYSRQTDRLWTK-----NRGYDSVSGCYGVNLDRNFDYGWDGTGSTSNP 487
            :...||:..:.|.......|.|...:||     |||...:  .|.....:..:.||...|.....
Mouse   208 KHTQWYYFQVTNTQAEIVYRFTIVNFTKPASLYNRGMKPL--FYSEKEAKTHNIGWQRIGDQIKY 270

  Fly   488 CKNL--YRGAHSFS------EPESRAVCSF-------LSGMREYLGAYVS--------------- 522
            .||.  ..|.|.||      .|.|:..|.|       .|.::|||....|               
Mouse   271 YKNNLGQDGRHFFSLTWTFQFPHSQDTCYFAHCYPYTYSNLQEYLSGINSDPVRSKFCKIRVLCH 335

  Fly   523 -LGG---YGQAITYPWGDADYVTENQRNLKQTARRAVLALRRLNQAEYSS 568
             |..   |...||.|...:|           :.|:||:...|::..|.:|
Mouse   336 TLARNMVYVLTITTPLKTSD-----------SKRKAVILTARVHPGETNS 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42264NP_572260.2 Propep_M14 <241..293 CDD:280416
M14_CP_A-B_like 328..633 CDD:199844 41/180 (23%)
Agbl3NP_001276585.1 M14_AGBL2-3_like 315..576 CDD:133117 14/71 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 790..810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.