DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42264 and AGBL5

DIOPT Version :9

Sequence 1:NP_572260.2 Gene:CG42264 / 31504 FlyBaseID:FBgn0259149 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_068603.4 Gene:AGBL5 / 60509 HGNCID:26147 Length:886 Species:Homo sapiens


Alignment Length:386 Identity:69/386 - (17%)
Similarity:116/386 - (30%) Gaps:144/386 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 VLASPDAQFNEVVALFALTFVALIGSVFGQKLLLWRSVSVPEISGISGLPLALLTLNSSELYEST 181
            :.:|||.:||                       :|......|....:|        |.|..|.|.
Human    46 IASSPDYEFN-----------------------VWTRPDCAETEFENG--------NRSWFYFSV 79

  Fly   182 LEGLQWLSPMDLRRFDFISPGSSYQINRRYRNGSQVQRYYGFQLWKVHETRLEQPELRAFWRHFG 246
            ..|:               ||...:||  ..|.::..:.|...:.....|...:|.    |....
Human    80 RGGM---------------PGKLIKIN--IMNMNKQSKLYSQGMAPFVRTLPTRPR----WERIR 123

  Fly   247 SEVWNINQDGIDILIEQRNVADARKFMDKVG------YSYNIMIDDIE---SAIDESYVE-VPAV 301
                  ::...::...|..::...:|::..|      :.|.....|.:   :.:|:.:.| .|..
Human   124 ------DRPTFEMTETQFVLSFVHRFVEGRGATTFFAFCYPFSYSDCQELLNQLDQRFPENHPTH 182

  Fly   302 EHPLDSVRNNSLPWMEVPGSTMNWRRYHDQADIKQFLQTLLETYSEN---VELIQI----GVTRN 359
            ..|||::                  .||.:          |..||.:   |:|:.|    |:..:
Human   183 SSPLDTI------------------YYHRE----------LLCYSLDGLRVDLLTITSCHGLRED 219

  Fly   360 KRP-LEVIRVSNGNPDNWAVFVDAG-----LQARDWLSPAALTYAISKLTHLWGRPKGKDKGEGQ 418
            :.| ||.:......|   ..|..||     |.:|........::..:.......||.        
Human   220 REPRLEQLFPDTSTP---RPFRFAGKRIFFLSSRVHPGETPSSFVFNGFLDFILRPD-------- 273

  Fly   419 RQSRAEKAMRRIDWYFLPLANPDGYQYSRQTDRLWTKNRGYDSVSGCY-----GVNLDRNF 474
             ..||:...|...:..:|:.||||.                  |.|.|     ||||:|.:
Human   274 -DPRAQTLRRLFVFKLIPMLNPDGV------------------VRGHYRTDSRGVNLNRQY 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42264NP_572260.2 Propep_M14 <241..293 CDD:280416 6/60 (10%)
M14_CP_A-B_like 328..633 CDD:199844 36/165 (22%)
AGBL5NP_068603.4 M14_AGBL5_like 176..568 CDD:199860 41/198 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 344..364
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 605..734
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 784..848
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.