DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42264 and cpb1

DIOPT Version :9

Sequence 1:NP_572260.2 Gene:CG42264 / 31504 FlyBaseID:FBgn0259149 Length:634 Species:Drosophila melanogaster
Sequence 2:XP_031758320.1 Gene:cpb1 / 496994 XenbaseID:XB-GENE-853710 Length:414 Species:Xenopus tropicalis


Alignment Length:438 Identity:106/438 - (24%)
Similarity:199/438 - (45%) Gaps:60/438 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 SQVQRYYGFQLWKVHETRLEQPELRAFWRHFGSEVWNINQ-DGIDI-------LIEQRNVAD--- 268
            ::.:.::|.::::|.....|..||          :.::.| :|:|.       |:||...||   
 Frog    15 AEPRNFHGEKVFRVIPQNAEHVEL----------IKSMAQTEGLDFWLPDSAQLVEQGKRADFHA 69

  Fly   269 -------ARKFMDKVGYSYNIMIDDIESAIDESYVEVPAVEHPLDSVRNNSLPWMEVPGSTMNWR 326
                   .:..:.:.|..|.|:|:|::.|:::.              |::::      .:..::.
 Frog    70 DGHVSYEVQALLQQSGMPYEILINDLQDALEKQ--------------RDSNI------RAVHSYE 114

  Fly   327 RYHDQADIKQFLQTLLETYSENVELIQIGVTRNKRPLEVIRVSNGNPDNWAVFVDAGLQARDWLS 391
            :|:|...|..:...:.......|....||.:...||:.:::|.....:..|||:|.|..||:|:|
 Frog   115 KYNDLDTINAWSANIAAQNPGLVSRSSIGTSYQGRPIYLLKVGKSGANKKAVFIDCGFHAREWIS 179

  Fly   392 PAALTYAISKLTHLWGRPKGKDKGEGQRQSRAEKAMRRIDWYFLPLANPDGYQYSRQTDRLWTKN 456
            ||...:.:.:....:|           .:|.....:..:|.|.||:.|.|||.|:..|:|:|.|.
 Frog   180 PAFCQWFVKEAVSAYG-----------VESEFTSLLDNLDIYVLPVLNVDGYVYTWTTNRMWRKT 233

  Fly   457 RGYDSVSGCYGVNLDRNFDYGWDGTGSTSNPCKNLYRGAHSFSEPESRAVCSFLSGMREYLGAYV 521
            |..:..|.|.|.:.:|||:.||...|:::..|...|.|:...||||::|:.:|:......:..|:
 Frog   234 RSANPNSTCIGTDPNRNFNAGWCTAGASTRACDETYCGSAPESEPETKALANFIRANIPAIKGYL 298

  Fly   522 SLGGYGQAITYPWGDADYVTENQRNLKQTARRAVLALRRLNQAEYSSGTSYRQKLARPGNSADWV 586
            ::..|.|.:.:|:..:..|.::...|...|:.||.:|..|.:.:|:.|..........|.|.||.
 Frog   299 TIHSYSQMLLFPYSYSYAVAKDHNELNAVAQGAVNSLTSLYKTKYTYGPGGSTIYLAAGGSDDWA 363

  Fly   587 QDRIGPQLVFNMFLKDQGRYGYLLPPHYIVESGEEVFEFLRIIAQQLQ 634
            .| .|.:..:...|:|.||||:.||...|..:.||....::.||..::
 Frog   364 YD-AGVKFSYTFELRDTGRYGFALPESQIKPTCEETMLAVKYIASYIK 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42264NP_572260.2 Propep_M14 <241..293 CDD:280416 14/69 (20%)
M14_CP_A-B_like 328..633 CDD:199844 86/304 (28%)
cpb1XP_031758320.1 Propep_M14 31..102 CDD:396700 17/80 (21%)
M14_CPB 111..410 CDD:349443 86/310 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X86
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.