DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42264 and CG8539

DIOPT Version :9

Sequence 1:NP_572260.2 Gene:CG42264 / 31504 FlyBaseID:FBgn0259149 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster


Alignment Length:335 Identity:103/335 - (30%)
Similarity:151/335 - (45%) Gaps:51/335 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 GSTMNWRRYHDQADIKQFLQTLLETYSENVELIQIGVTRNKRPLEVIRVSNGN--PDNWAVFVDA 382
            |..:....|.....|.|:|..|..::|..|.|..:..|...|.|::..::||:  |....:|:||
  Fly    30 GLMLQLDNYLSYDGIMQYLDELALSHSNRVTLKDVARTYENRALKMAIITNGDGRPGKRVIFLDA 94

  Fly   383 GLQARDWLSPAALTYAISKLTHLWGRPKGKDKGEGQRQSRAEKA--MRRIDWYFLPLANPDGYQY 445
            .|.:|:|::|||....|.||.                ...||.:  :...||:.:||||||||:|
  Fly    95 ALHSREWMTPAAALLTIHKLV----------------VEFAENSDLLTDYDWHIMPLANPDGYEY 143

  Fly   446 SRQTDRLW----TKNRGYDSVSGCYGVNLDRNFDYGWD-GTGSTSNPCKNLYRGAHSFSEPESRA 505
            ||.|:|.|    |.|.|     .|:|.||:|||...|: |.....:||...|.|:..|||.|:|.
  Fly   144 SRNTERYWRNTRTPNGG-----NCFGTNLNRNFAVDWNVGFPELKDPCDENYAGSSPFSEVEART 203

  Fly   506 VCSFLSGMREYLGA--YVSLGGYGQAITYPW-GDADYVTENQRNLKQTARRAVLALRRLNQAEYS 567
            |...:.|:.|...|  |:||....:::.||| .|.|.|: ||:...:..|   ....|:.|   |
  Fly   204 VRDIMHGLVESKRAVMYLSLHTANRSVFYPWVYDTDPVS-NQKEHDEIGR---FVADRILQ---S 261

  Fly   568 SGTSYR----QKLARP--GNSADWVQDRIGPQLVFNMFLKDQGR----YGYLLPPHYIVESGEEV 622
            :||..:    .|.|..  |.|.|:.. ..|..|.|...:...||    |.:..|...|....||.
  Fly   262 TGTFIKTWQYAKYAGTFGGTSMDYAL-LAGFPLSFVFEMSGTGRDHVEYKFFPPARDIRHLAEES 325

  Fly   623 FEFLRIIAQQ 632
            :..::..|::
  Fly   326 WTGIKAFAEK 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42264NP_572260.2 Propep_M14 <241..293 CDD:280416
M14_CP_A-B_like 328..633 CDD:199844 102/327 (31%)
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 102/325 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467006
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.