DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42264 and CG8560

DIOPT Version :9

Sequence 1:NP_572260.2 Gene:CG42264 / 31504 FlyBaseID:FBgn0259149 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_001261516.1 Gene:CG8560 / 38830 FlyBaseID:FBgn0035781 Length:418 Species:Drosophila melanogaster


Alignment Length:389 Identity:99/389 - (25%)
Similarity:179/389 - (46%) Gaps:59/389 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 VQRYYGFQLWKVHETRLEQPELRAFWRHFGSEVWNI------------------NQDGIDILIEQ 263
            |:.|.|::::.::.....:.:|  ..|..|:|.::.                  :|:|.:.|:| 
  Fly    18 VENYDGYKIYDINARNAFEKQL--LLRLSGNEAYDFFDLPRSLDASSRVMVKPEDQEGFEHLLE- 79

  Fly   264 RNVADARKFMDKVGYSYNIMIDDIESAIDESYVEVPAVEHPLDSVRNNSLPWMEVPGSTMNWRRY 328
                       |.|.:|        |.|:|::.|  ::....|..:|..|..:.....:::::.:
  Fly    80 -----------KYGVNY--------SVINENFGE--SLRQERDENQNQRLMNLRSAERSVSFKAF 123

  Fly   329 HDQADIKQFLQTLLETYSENVELIQIGVTRNKRPLEVIRVSNGNPDNW--AVFVDAGLQARDWLS 391
            |..|:|..:|..|...|...|.:...|.:...|.::.|.::||:....  .||:|||:.||:|::
  Fly   124 HRHAEINAYLDELAAAYPSRVSVQVAGKSYENRDIKTITITNGDGKTGKNVVFLDAGIHAREWIA 188

  Fly   392 PAALTYAISKLTHLWGRPKGKDKGEGQRQSRAEKAMRRIDWYFLPLANPDGYQYSRQTDRLWTKN 456
            .|...|.|.:|.              :..:...:.::..||..||:.|||||:||..|.|:|.|.
  Fly   189 HAGALYVIHQLV--------------ENFAANSELLKDFDWVILPVVNPDGYEYSHTTTRMWRKT 239

  Fly   457 RGYDSVSGCYGVNLDRNFDYGWDGTGSTSNPCKNLYRGAHSFSEPESRAVCSFLSGMREYLGAYV 521
            |...| |.|||.:.:||||:.|...|::|..|.:.::|..:|||||::.:...|..:......|:
  Fly   240 RKPIS-SACYGTDANRNFDFHWGEVGASSYSCSDTFKGETAFSEPETQLIRDILLSLTGRGKFYL 303

  Fly   522 SLGGYGQAITYPWGDADYVTENQRNLKQTARRAVLALRRLNQAEYSSGTSYRQKLARPGNSADW 585
            :|..||..:.||||....:..:.|:..:.|:....|::.....:|:.|:|.....|..|.|.|:
  Fly   304 TLHSYGNYLLYPWGWTSALPSSWRDNDEVAQGGADAIKSATGTKYTVGSSTNVLYAAAGGSDDY 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42264NP_572260.2 Propep_M14 <241..293 CDD:280416 12/69 (17%)
M14_CP_A-B_like 328..633 CDD:199844 78/260 (30%)
CG8560NP_001261516.1 Propep_M14 29..98 CDD:280416 15/92 (16%)
M14_CP_A-B_like 123..414 CDD:199844 78/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467009
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.