DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42264 and CG8564

DIOPT Version :9

Sequence 1:NP_572260.2 Gene:CG42264 / 31504 FlyBaseID:FBgn0259149 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster


Alignment Length:339 Identity:95/339 - (28%)
Similarity:148/339 - (43%) Gaps:59/339 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 YHDQADIKQFLQTLLETYSENVELIQIGVTRNKRPLEVIRVSNGNPDN----------------- 375
            |.|...:.|:||.|.:.|:..|.:..:|.|..||.:..:.::..|.:|                 
  Fly    54 YLDYKQVNQYLQYLAQRYAHFVHVHILGHTHEKREIRALEINWMNSENVELSPQMREHSPRLFDI 118

  Fly   376 ------------------WAVFVDAGLQARDWLSPAALTYAISKLTHLWGRPKGKDKGEGQRQSR 422
                              ..||::||..||:|:|.:.....|.:||              :|.:|
  Fly   119 GPNGRFTVPVIHVGEHCRKTVFIEAGTHAREWISVSTALNCIYQLT--------------ERYTR 169

  Fly   423 AEKAMRRIDWYFLPLANPDGYQYSRQTDRLWTKNRGYDSVSGCYGVNLDRNFDYGWDGTGSTSNP 487
            ..:.:|::.:..:||.|||||:|||..:..|.|||.....:...|.:.:||:|..|:...|..| 
  Fly   170 NIEVLRKLRFIIVPLVNPDGYEYSRTKNPKWRKNRRPHKSAKFVGTDCNRNYDIFWNSGPSKIN- 233

  Fly   488 CKNLYRGAHSFSEPESRAVCSFLSGMREYLGAYVSLGGYGQAITYPWGDADYVTENQ---RNLKQ 549
             :|.|:|...|||||:||:...|..|...|..::||..|||:|.||||   |..:|.   |.|..
  Fly   234 -RNTYKGESPFSEPETRAMRCILDRMSSNLLFFLSLHSYGQSIMYPWG---YCRDNPIYWRELSS 294

  Fly   550 TARRAVLALRRLNQAEYSSGT-SYRQKLARPGNSADWVQDRIGPQLVFNMFLKDQGRYGYLLPPH 613
            .|.....|::..|..||.:|: |...|....|:..|:|...:...:...|.|..: ..|:..|..
  Fly   295 LANSGKSAIKSYNGREYRTGSISCLTKRTIAGSVVDYVYGVLKVPMALVMELPSR-ELGFQPPVE 358

  Fly   614 YIVESGEEVFEFLR 627
            .|.:.|.|.:..:|
  Fly   359 MISQIGHESWYGIR 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42264NP_572260.2 Propep_M14 <241..293 CDD:280416
M14_CP_A-B_like 328..633 CDD:199844 95/339 (28%)
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 95/339 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.