DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42264 and CG12374

DIOPT Version :9

Sequence 1:NP_572260.2 Gene:CG42264 / 31504 FlyBaseID:FBgn0259149 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_610819.1 Gene:CG12374 / 36410 FlyBaseID:FBgn0033774 Length:422 Species:Drosophila melanogaster


Alignment Length:443 Identity:120/443 - (27%)
Similarity:207/443 - (46%) Gaps:73/443 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 GSQVQRYYGFQLWKVH-ETRLEQPELRAFWRHFGSEVWNINQDG-----IDILIE---QRNVADA 269
            |....||..|:::::. ||.|:..||:....|.  .|..:|:.|     .::::.   .|.:...
  Fly    21 GRMAARYDHFRIYQLTIETNLQMEELKKIHEHI--SVHFLNELGAVGNKYNVIVGPLFHRALEKT 83

  Fly   270 RKFMDKVGYSYNIMIDDIESAIDESYVEVPAVEHPLDSVRNNSLPWMEVPGSTMNWRRYHDQADI 334
            .||::.|   |.:::||::..||||            ||.::         |.|.|..||.    
  Fly    84 LKFLEIV---YEVIVDDLQKLIDES------------SVGDD---------SQMEWETYHT---- 120

  Fly   335 KQFLQTLLETYSEN------VELIQIGVTRNKRPLEVIRVSNGNPDNWAVFVDAGLQARDWLSPA 393
               |.|:.:...:.      :|...||.:...|.::.||:|. ...|.|:|::..:.|.:|:|.|
  Fly   121 ---LDTIYDWIDQECAAHDFLECKVIGQSYEGRDIKSIRLSK-RSGNKAIFLEGNIHAMEWISSA 181

  Fly   394 ALTYAISKLTHLWGRPKGKDKGEGQRQSRAEKAMRRIDWYFLPLANPDGYQYSRQTDRLWTKNR- 457
            .:|:.:::|.:       .:..|.||.|      ...||..:|:.||||:.|:.:.:|||.||| 
  Fly   182 TVTFLLNQLIN-------SEDPEMQRLS------EEYDWIVVPMVNPDGFVYTHEVERLWRKNRR 233

  Fly   458 --GYDSVSG-CYGVNLDRNFDYGWDGTG-STSNPCKNLYRGAHSFSEPESRAVCSFLSGMRE-YL 517
              ||.:.|| |||::::|||||.|.|.| :...||.:.:.|....:|.|..::.:|:|...: |:
  Fly   234 PNGYRNESGDCYGIDMNRNFDYHWGGAGWNIDEPCDHWFGGEEPNTEVEIISLQNFVSSFEDGYI 298

  Fly   518 GAYVSLGGYGQAITYPWGDADYVTENQRNLKQTARRAVL---ALRRLNQAEYSSGTSYRQKLARP 579
            .:|::...|||.:..|:|.::  ||...|.:|..|.|..   |...:..:.::.|.|........
  Fly   299 RSYMAYHAYGQYVLLPYGHSN--TEFPPNYEQMKRIAAAFSDAAADVYGSTFTYGASGLLNYVVS 361

  Fly   580 GNSADWVQDRIGPQLVFNMFLKDQGRYGYLLPPHYIVESGEEVFEFLRIIAQQ 632
            |.:.||............:.|:|:|.:|:.||.:.|.|.|.||...|:.:..:
  Fly   362 GAAKDWAYGVKKIPFTCTVELRDKGTFGFFLPSNQITEVGLEVTAGLKALVNK 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42264NP_572260.2 Propep_M14 <241..293 CDD:280416 12/59 (20%)
M14_CP_A-B_like 328..633 CDD:199844 91/320 (28%)
CG12374NP_610819.1 Propep_M14 34..104 CDD:280416 17/74 (23%)
M14_CP_A-B_like 118..415 CDD:199844 91/320 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467038
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X86
76.850

Return to query results.
Submit another query.