DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42264 and Cpa6

DIOPT Version :9

Sequence 1:NP_572260.2 Gene:CG42264 / 31504 FlyBaseID:FBgn0259149 Length:634 Species:Drosophila melanogaster
Sequence 2:XP_011236694.1 Gene:Cpa6 / 329093 MGIID:3045348 Length:459 Species:Mus musculus


Alignment Length:394 Identity:104/394 - (26%)
Similarity:178/394 - (45%) Gaps:53/394 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 WLSPMDLRRFDFISPGSSYQINRRYRNGSQVQRYYGFQLWKVHETRLEQPELRAFWRHFGSEVWN 251
            ||      ..:.:.||..:..:.||. |.:|.|.       :.::..|...|:..:.....::|.
Mouse    19 WL------LLNILKPGHCHSYDNRYA-GDKVIRL-------IPKSEEEALALKNIYHQLKVDLWQ 69

  Fly   252 ------INQDGI-DILIEQRNVADARKFMDKVGYSYNIMIDDIESAIDESYVEVPAVEHPLDSVR 309
                  :::..| |:.|.|........|:.:....|.::|:|::.|::.        |:.|.:.|
Mouse    70 PSSISYVSEGTITDVHISQNASRTLLAFLQETHIYYKVLIEDLQKAVEN--------ENSLQTQR 126

  Fly   310 N-NSLPWMEVPGSTMNWRRYHDQADIKQFLQTLLETYSENVELIQIGVTRNKRPLEVIRVS-NGN 372
            | .||       |..|:..||...||:.:|..|.:|....|.:..||.:...|||.::::. ...
Mouse   127 NRRSL-------SEYNYEVYHSLEDIQSWLHHLNQTQPGLVRVFSIGRSYEGRPLFIMQLGRKSR 184

  Fly   373 PDNWAVFVDAGLQARDWLSPAALTYAISK--LTHLWGRPKGKDKGEGQRQSRAEKAMRRIDWYFL 435
            ....||::|.|:.||:|:.||...:.:.:  ||:             :.....:|.:..:.:|.:
Mouse   185 AYKRAVWIDCGIHAREWIGPAFCQWFVREAILTY-------------KTDPAMKKMLNHLYFYIM 236

  Fly   436 PLANPDGYQYSRQTDRLWTKNRGYDSVSGCYGVNLDRNFDYGWDGTGSTSNPCKNLYRGAHSFSE 500
            |:.|.|||.:|...||.|.|.|..||...|.||:.:||:...|...|::::||.:.|.|....||
Mouse   237 PVFNVDGYHFSWTHDRFWRKTRSRDSKFRCRGVDANRNWKVKWCDEGASAHPCDDTYCGPFPESE 301

  Fly   501 PESRAVCSFLSGMREYLGAYVSLGGYGQAITYPWGDADYVTENQRNLKQTARRAVLALRRLNQAE 565
            ||.:||.:||...|:.:.||:|...|.|.:.||:........|...::..|.:||.|||.::...
Mouse   302 PEVKAVANFLRKHRKRIRAYLSFHAYAQMLLYPYSYKYATIPNFSCVEFAAHKAVKALRSVHGIR 366

  Fly   566 YSSG 569
            |..|
Mouse   367 YRHG 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42264NP_572260.2 Propep_M14 <241..293 CDD:280416 10/58 (17%)
M14_CP_A-B_like 328..633 CDD:199844 75/245 (31%)
Cpa6XP_011236694.1 Propep_M14 48..119 CDD:366995 12/78 (15%)
Peptidase_M14_like 138..382 CDD:386095 75/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848123
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X86
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.