DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42264 and CG32379

DIOPT Version :9

Sequence 1:NP_572260.2 Gene:CG42264 / 31504 FlyBaseID:FBgn0259149 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster


Alignment Length:335 Identity:86/335 - (25%)
Similarity:157/335 - (46%) Gaps:35/335 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 YNIMIDDIESAIDESYVEVPAVEHPLDSVRNNSL---PWMEVPGSTMNWRRYHDQADIKQFLQTL 341
            |.::|:|:...:.....|         ::|...|   |.::|..:      ::..::|..:|.:|
  Fly     8 YKVLIEDLAPLVHAQRAE---------NLRKKLLIQWPHIDVLSA------FYTHSEINDYLDSL 57

  Fly   342 LETYSENVELIQIGVTRNKRPLEVIRVSNGN--PDNWAVFVDAGLQARDWLSPAALTYAISKLTH 404
            ||.:.:.|::.|.|.:..:|||:|:.::||:  .:...:.:|..:.||:|:||:...|.|.:|..
  Fly    58 LERFPKRVQVKQFGWSYERRPLKVLTITNGDGRRNKPVILIDGTVHAREWISPSMALYIIQQLLD 122

  Fly   405 LWGRPKGKDKGEGQRQSRAEKAMRRIDWYFLPLANPDGYQYSRQTDRLWTKNRGYDSVSGCYGVN 469
            .:|     |.         ::.::..||..:|:.|.|||:|:....|.|.|:|...|...|.|.:
  Fly   123 NYG-----DN---------QELLQDYDWVIMPVVNADGYEYTHTDSRYWRKSRRPTSNPECIGTD 173

  Fly   470 LDRNFDYGW-DGTGSTSNPCKNLYRGAHSFSEPESRAVCSFLSGMREYLGAYVSLGGYGQAITYP 533
            ::|||.|.| ...||:|:||:|:|||...|.:.||:.:...:...:..|..|:||..||.....|
  Fly   174 INRNFGYEWGHDEGSSSDPCENIYRGERPFDQSESQVLRDVMLHYKGRLNFYLSLHSYGNYFLLP 238

  Fly   534 WGDADYVTENQRNLKQTARRAVLALRRLNQAEYSSGTSYRQKLARPGNSADWVQDRIGPQLVFNM 598
            ||......:..:::...|.....|:.......||.|::|.......|::.|:....:...:...|
  Fly   239 WGYTSDFPDTYQDMMSVADAGAKAIIYSTNGIYSYGSTYYVLYPTSGDTTDFAFGVVNATVAMTM 303

  Fly   599 FLKDQGRYGY 608
            .|...|..|:
  Fly   304 ELPAAGFQGF 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42264NP_572260.2 Propep_M14 <241..293 CDD:280416 3/12 (25%)
M14_CP_A-B_like 328..633 CDD:199844 78/284 (27%)
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 78/284 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467012
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.