DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42264 and AGTPBP1

DIOPT Version :9

Sequence 1:NP_572260.2 Gene:CG42264 / 31504 FlyBaseID:FBgn0259149 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_001273644.1 Gene:AGTPBP1 / 23287 HGNCID:17258 Length:1278 Species:Homo sapiens


Alignment Length:494 Identity:100/494 - (20%)
Similarity:146/494 - (29%) Gaps:171/494 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 LTLNS---SELYESTLEGLQWLSPMDLRRFDF----ISPGSSYQINRRYRNGSQVQRYYGFQ--L 225
            |.|||   |..|.      ||        |.|    :.||.:|:.|......|..|..||.|  :
Human   786 LILNSDINSNHYH------QW--------FYFEVSGMRPGVAYRFNIINCEKSNSQFNYGMQPLM 836

  Fly   226 WKVHETRLEQP-------ELRAFWRHFG-SEVWNINQDG-----IDILIEQRNVADARKFMDKVG 277
            :.|.|....:|       ::..:..||. |.|....|.|     |...:...:..|...|.....
Human   837 YSVQEALNARPWWIRMGTDICYYKNHFSRSSVAAGGQKGKSYYTITFTVNFPHKDDVCYFAYHYP 901

  Fly   278 YSYNIM---IDDIESAIDESYVEVPAVEHPLDSVRNNSLPWMEVPGSTMNWRRYHDQADIKQFLQ 339
            |:|:.:   :..:|||                                      |:...|.....
Human   902 YTYSTLQMHLQKLESA--------------------------------------HNPQQIYFRKD 928

  Fly   340 TLLETYSEN-VELIQIGVTRNKRPLEVIRVSNGNPDNWAVFVDA----GLQARDWLSPAALTYAI 399
            .|.||.|.| ..|:.|.........|.|......|   .||:.|    |.....|:....|.|.:
Human   929 VLCETLSGNSCPLVTITAMPESNYYEHICHFRNRP---YVFLSARVHPGETNASWVMKGTLEYLM 990

  Fly   400 SKLTHLWGRPKGKDKGEGQRQSRAEKAMRRIDWYFLPLANPDGYQYSRQTDRLWTKNRGYDSVSG 464
            |      ..|..        ||..|..:.:|    :|:.||||.                  ::|
Human   991 S------NNPTA--------QSLRESYIFKI----VPMLNPDGV------------------ING 1019

  Fly   465 CY-----GVNLDRNFDYGWDGTGSTSNPCKNLYRGAHSFSEPESRAVCSFLSGMREYLGA----- 519
            .:     |.:|:|.    |.......:|  .:|..                .|:.:||.|     
Human  1020 NHRCSLSGEDLNRQ----WQSPSPDLHP--TIYHA----------------KGLLQYLAAVKRLP 1062

  Fly   520 --YVSLGG---------YGQAITYP-WGDADYVTENQRNLKQTARRAV-LALRRLNQAEYSSGTS 571
              |....|         ||.:|... |...|..|... .::.|..|.: ..|..:..|...|..|
Human  1063 LVYCDYHGHSRKKNVFMYGCSIKETVWHTNDNATSCD-VVEDTGYRTLPKILSHIAPAFCMSSCS 1126

  Fly   572 YRQKLARPGNSADWVQDRIGPQLVFNMFLK----DQGRY 606
            :..:.::...:...|...||.|..:.|...    |||:|
Human  1127 FVVEKSKESTARVVVWREIGVQRSYTMESTLCGCDQGKY 1165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42264NP_572260.2 Propep_M14 <241..293 CDD:280416 14/60 (23%)
M14_CP_A-B_like 328..633 CDD:199844 64/311 (21%)
AGTPBP1NP_001273644.1 M14_Nna1 911..1188 CDD:133116 67/355 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.