DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42264 and Agbl5

DIOPT Version :9

Sequence 1:NP_572260.2 Gene:CG42264 / 31504 FlyBaseID:FBgn0259149 Length:634 Species:Drosophila melanogaster
Sequence 2:XP_036020907.1 Gene:Agbl5 / 231093 MGIID:2441745 Length:1007 Species:Mus musculus


Alignment Length:406 Identity:78/406 - (19%)
Similarity:124/406 - (30%) Gaps:159/406 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 ASPDAQFNEVVALFALTFVALIGSVFGQKLLLWRSVSVPE------------ISGISGLPLALLT 171
            ||||.:||                       :|......|            .|...|.|..|:.
Mouse   140 ASPDYEFN-----------------------VWTRPDCAETEYENGNRSWFYFSVRGGTPGKLIK 181

  Fly   172 LN------SSELYESTLEGLQWLSPM-----DLRRFDFISPGSSYQINRRY--------RNGSQV 217
            :|      .|:||.      |.::|.     ...|::.|....::::..:.        ..||.|
Mouse   182 INIMNMNKQSKLYS------QGMAPFVRTLPSRPRWERIRERPTFELGSKLSPCFSKPEEAGSHV 240

  Fly   218 QRYYGFQLWKVHETRLEQPELRAFWRHFGSEVWNINQDGIDILIEQRNVADARKFMDKVGYSYNI 282
            :...|.:|.|:.||:.    :.:|...|               :|.|.......|.....||   
Mouse   241 ESVRGRELVKMTETQF----VLSFVHRF---------------VEGRGATTFFAFCYPFSYS--- 283

  Fly   283 MIDDIESAIDESYVE-VPAVEHPLDSVRNNSLPWMEVPGSTMNWRRYHDQADIKQFLQTLLETYS 346
            ...|:.|.:|:.:.| ......||||:                  .||.:          |..||
Mouse   284 DCQDLLSQLDQRFSENYSTHSSPLDSI------------------YYHRE----------LLCYS 320

  Fly   347 EN---VELIQI----GVTRNKRP-LEVIRVSNGNPDNW-----AVFVDAGLQARDWLSPAALTYA 398
            .:   |:|:.|    |:..::.| ||.:....|.|..:     .:|.   |.:|........::.
Mouse   321 LDGLRVDLLTITSCHGLRDDREPRLEQLFPDLGTPRPFRFTGKRIFF---LSSRVHPGETPSSFV 382

  Fly   399 ISKLTHLWGRPKGKDKGEGQRQSRAEKAMRRIDWYFLPLANPDGYQYSRQTDRLWTKNRGYDSVS 463
            .:.......||.         ..||:...|...:..:|:.||||.                  |.
Mouse   383 FNGFLDFILRPD---------DPRAQTLRRLFVFKLIPMLNPDGV------------------VR 420

  Fly   464 GCY-----GVNLDRNF 474
            |.|     ||||:|.:
Mouse   421 GHYRTDSRGVNLNRQY 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42264NP_572260.2 Propep_M14 <241..293 CDD:280416 9/51 (18%)
M14_CP_A-B_like 328..633 CDD:199844 35/165 (21%)
Agbl5XP_036020907.1 Pepdidase_M14_N 102..>214 CDD:407865 19/102 (19%)
M14_AGBL5_like 304..695 CDD:349455 39/191 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.