DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42264 and CPO

DIOPT Version :9

Sequence 1:NP_572260.2 Gene:CG42264 / 31504 FlyBaseID:FBgn0259149 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_775100.1 Gene:CPO / 130749 HGNCID:21011 Length:374 Species:Homo sapiens


Alignment Length:326 Identity:100/326 - (30%)
Similarity:167/326 - (51%) Gaps:20/326 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 EHPLDSVRNNSLPW-MEVPGSTMNWRRYHDQADIKQFLQTLLETYSENVELIQIGVTRNKRPLEV 365
            :|..:.|..:..|| :|    |.::..||...:|.::::.:.|.|.|.|....:|||....|:..
Human    27 QHRQEIVDKSVSPWSLE----TYSYNIYHPMGEIYEWMREISEKYKEVVTQHFLGVTYETHPMYY 87

  Fly   366 IRVS--NGNPDNWAVFVDAGLQARDWLSPAALTYAISKLTHLWGRPKGKDKGEGQRQSRAEKAMR 428
            :::|  :|||.. .:::|.|:.||:|::||...:.:.::..     ..||      .|...|.:|
Human    88 LKISQPSGNPKK-IIWMDCGIHAREWIAPAFCQWFVKEILQ-----NHKD------NSSIRKLLR 140

  Fly   429 RIDWYFLPLANPDGYQYSRQTDRLWTKNRGYDSVSGCYGVNLDRNFDYGWDGTGSTSNPCKNLYR 493
            .:|:|.||:.|.|||.|:..|||||.|:|...:...|:|.:|:|||:..|...|::.|.....:.
Human   141 NLDFYVLPVLNIDGYIYTWTTDRLWRKSRSPHNNGTCFGTDLNRNFNASWCSIGASRNCQDQTFC 205

  Fly   494 GAHSFSEPESRAVCSFLSGMREYLGAYVSLGGYGQAITYPWGDADYVTENQRNLKQTARRAVLAL 558
            |....||||::||.||:...::.:..::::..|||.|..|:|.....:.|...:.|..::|..||
Human   206 GTGPVSEPETKAVASFIESKKDDILCFLTMHSYGQLILTPYGYTKNKSSNHPEMIQVGQKAANAL 270

  Fly   559 RRLNQAEYSSGTSYRQKLARPGNSADWVQDRIGPQLVFNMFLKDQGRYGYLLPPHYIVESGEEVF 623
            :......|..|:|.....|..|:|.||.:| ||....:...|:|.|.||::||...|..:.||..
Human   271 KAKYGTNYRVGSSADILYASSGSSRDWARD-IGIPFSYTFELRDSGTYGFVLPEAQIQPTCEETM 334

  Fly   624 E 624
            |
Human   335 E 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42264NP_572260.2 Propep_M14 <241..293 CDD:280416
M14_CP_A-B_like 328..633 CDD:199844 94/299 (31%)
CPONP_775100.1 M14_CPO 47..344 CDD:133105 94/302 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157742
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X86
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.