DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42264 and CG43235

DIOPT Version :10

Sequence 1:NP_572260.2 Gene:CG42264 / 31504 FlyBaseID:FBgn0259149 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_001245931.1 Gene:CG43235 / 12798301 FlyBaseID:FBgn0262880 Length:103 Species:Drosophila melanogaster


Alignment Length:108 Identity:20/108 - (18%)
Similarity:41/108 - (37%) Gaps:22/108 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 WLSPMDLRRFDFISPGSSYQINRRYRNGSQVQRYYGFQLWKVH-ETRLEQPELRAFWRHFGS-EV 249
            |.|.:.    |.|.|       |.|.|         :.::||. :||.:|..:....:...: .:
  Fly    14 WKSSLS----DPIGP-------RSYEN---------YSVYKVFIKTRSDQQVIDGLLKDTDNYNL 58

  Fly   250 WNINQDGIDILIEQRNVADARKFMDKVGYSYNIMIDDIESAID 292
            |:...:.:.|::...........|.|......::|.::::.||
  Fly    59 WHRGLNVVHIMVSPVEKDSFLAVMQKENIVVEVLIKNVQTLID 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42264NP_572260.2 Propep_M14 <241..293 CDD:460505 7/53 (13%)
Peptidase_M14 334..624 CDD:459730
CG43235NP_001245931.1 Propep_M14 33..102 CDD:460505 12/69 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.