DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42264 and AGBL1

DIOPT Version :9

Sequence 1:NP_572260.2 Gene:CG42264 / 31504 FlyBaseID:FBgn0259149 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_001373023.1 Gene:AGBL1 / 123624 HGNCID:26504 Length:1121 Species:Homo sapiens


Alignment Length:227 Identity:48/227 - (21%)
Similarity:74/227 - (32%) Gaps:68/227 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 EVVALFALTFVALIGSVFGQKLL--LW------RSVSVPEISGISGLPLALLTLNSSELYESTLE 183
            |:.||.....:|......||.||  ||      .|||:..:.||:|....|..:           
Human    97 ELEALDVTLILARKNLSHGQNLLHCLWALRVFASSVSMGAMLGINGAMELLFKV----------- 150

  Fly   184 GLQWLSPMDLRRFDFISPGS--------SYQINRRYRNGSQVQRYYGF-QLWKVHETRLEQPELR 239
                ::|...:|...|...:        |....||..|...|....|. |.|..|:|.....::|
Human   151 ----ITPYTRKRTQAIRAATEVLAALLKSKSNGRRAVNRGYVTSLLGLHQDWHSHDTANAYVQIR 211

  Fly   240 AFWRHFGSEVWNINQDGIDILIEQRNVADARK----FMDKVGYSYNIMIDDIESAIDESYVEVPA 300
            .                 .:|:..|::|..|.    |:...|  ..|:....::.:|:..:| |.
Human   212 R-----------------GLLLCLRHIAALRSGREAFLAAQG--MEILFSTTQNCLDDKSME-PV 256

  Fly   301 VE------------HPLDSVRNNSLPWMEVPG 320
            :.            .||..|..:|.....|||
Human   257 ISVVLQILRQCYPTSPLPLVTASSAYAFPVPG 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42264NP_572260.2 Propep_M14 <241..293 CDD:280416 7/55 (13%)
M14_CP_A-B_like 328..633 CDD:199844
AGBL1NP_001373023.1 Pepdidase_M14_N 596..730 CDD:407865
M14_Nna1 754..1019 CDD:349477
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.