DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42264 and LOC105947369

DIOPT Version :10

Sequence 1:NP_572260.2 Gene:CG42264 / 31504 FlyBaseID:FBgn0259149 Length:634 Species:Drosophila melanogaster
Sequence 2:XP_012818774.2 Gene:LOC105947369 / 105947369 XenbaseID:XB-GENE-29089539 Length:419 Species:Xenopus tropicalis


Alignment Length:68 Identity:17/68 - (25%)
Similarity:32/68 - (47%) Gaps:16/68 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QWMEAKSQRIDPDAENE-LWDSIKHTKVQNIVEKNAIGEINSPPTDGTPYLKVVCISDTHEQLHN 81
            ||..:.:    .||:.| |:.::|.|:.::.||.:.....:..|.|           .|:.|||:
 Frog   518 QWRSSPA----ADAQEENLYAAVKDTQPEDGVEMDTRAAASEAPQD-----------VTYAQLHS 567

  Fly    82 VTV 84
            :|:
 Frog   568 LTL 570

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42264NP_572260.2 Propep_M14 <241..293 CDD:460505
Peptidase_M14 334..624 CDD:459730
LOC105947369XP_012818774.2 Propep_M14 28..104 CDD:460505
Peptidase_M14_like 116..415 CDD:472171
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.