DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42264 and LOC105947369

DIOPT Version :9

Sequence 1:NP_572260.2 Gene:CG42264 / 31504 FlyBaseID:FBgn0259149 Length:634 Species:Drosophila melanogaster
Sequence 2:XP_012818774.2 Gene:LOC105947369 / 105947369 -ID:- Length:419 Species:Xenopus tropicalis


Alignment Length:464 Identity:132/464 - (28%)
Similarity:216/464 - (46%) Gaps:91/464 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 LRRFDFISPGSSYQINRRY-----RNGSQVQ------RYYGFQLWKVHETRLEQPELRAFWR-HF 245
            :||||          |.:.     :|...||      |......||.|.:....|  :||.. |.
 Frog    19 IRRFD----------NEKALRVFPQNEEDVQFIKHLARVMQLNFWKPHSSSYVIP--KAFVDFHA 71

  Fly   246 GSEVWNINQDGIDILIEQRNVADARKFMDKVGYSYNIMIDDIESAIDESYVEVPAVEHPLD---- 306
            .:|..:|    |..|:|::            |..:.|:..:::.||:.   ::....:|.|    
 Frog    72 NAEDSHI----ITGLLEEK------------GIKHRILFQNLQEAIEN---QLSKAGNPKDERFP 117

  Fly   307 SVRNNSLPWMEVPGSTMNWRRYHDQADIKQFLQTLLETYSENVELIQIGVTRNKRPLEVIRVSNG 371
            |.|..:  |:|:  ||..:|     ..:|         |...|.::|.|.|...:.:.|::|.:.
 Frog   118 SPRYRT--WLEI--STWAYR-----VSVK---------YPNLVSVVQAGNTYEGQTILVLKVGSQ 164

  Fly   372 NPDNWAVFVDAGLQARDWLSPAALTYAISKLTHLWGRPKGKDKGEGQRQSRAEKAMRRIDWYFLP 436
            :.....:.::.|:.||:|:|||...:.:::..    |..||||.       ..|.:..:.::.:|
 Frog   165 SAHKKGIVLECGVHAREWISPAFCQWFVNEAI----RSYGKDKA-------MTKLLNSVTFHVVP 218

  Fly   437 LANPDGYQYSRQTDRLWTKNRGYDSVSGCYGVNLDRNFDYGWDGTG-STSNPCKNLYRGAHSFSE 500
            :.|.|||.::...||:|.|||..|:.:.|.||:|:|||:..| ||| |...||..:|.|:...||
 Frog   219 VFNVDGYIWTWTHDRMWRKNRYQDANNKCVGVDLNRNFNASW-GTGFSNDEPCSEIYAGSGPESE 282

  Fly   501 PESRAVCSFLSGMREYLGAYVSLGGYGQAITYPWGDADYVTENQRNLKQTARRAVLALRRLNQAE 565
            .|::||.|::......|.||:|...|||.:.||:|   |.:|...|.|:..:.||.||:.|:.. 
 Frog   283 NETKAVASYIRDNISSLKAYISFHAYGQMLMYPYG---YKSEKPPNSKKLDKIAVSALKALSTL- 343

  Fly   566 YSSGTSYRQ-KLAR-----PGNSADWVQDRIGPQLVFNMFLKDQGRYGYLLPPHYIVESGEEVFE 624
              .||||.. .:|.     .|:|.||..|. |.:..|...|:|:|:||:|||.:.|.::..|...
 Frog   344 --YGTSYTHGPIATTIYPVSGSSIDWAYDE-GMKYSFAFELRDEGQYGFLLPENQIKKTCMETML 405

  Fly   625 FLRIIAQQL 633
            .::.||:.:
 Frog   406 AVKAIAKSV 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42264NP_572260.2 Propep_M14 <241..293 CDD:280416 11/52 (21%)
M14_CP_A-B_like 328..633 CDD:199844 98/311 (32%)
LOC105947369XP_012818774.2 Propep_M14 33..104 CDD:366995 20/91 (22%)
Peptidase_M14_like 116..415 CDD:386095 105/336 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X86
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.