DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42264 and cpo

DIOPT Version :9

Sequence 1:NP_572260.2 Gene:CG42264 / 31504 FlyBaseID:FBgn0259149 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_001139101.1 Gene:cpo / 100005630 ZFINID:ZDB-GENE-070619-6 Length:363 Species:Danio rerio


Alignment Length:307 Identity:87/307 - (28%)
Similarity:154/307 - (50%) Gaps:20/307 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 NWRRYHDQADIKQFLQTLLETYSENVELIQIGVTRNKRPLEVIRV--SNGNPDNWAVFVDAGLQA 386
            ::.:||...:|..::..:.....:.|..:..|.|..||.:.::::  |:..|.. |:::|.|:.|
Zfish    31 DYTKYHTMDEISAWMNQMQRENPDVVSTMTYGQTYEKRNITLLKIGFSSTTPKK-AIWMDCGIHA 94

  Fly   387 RDWLSPAALTYAISKLTHLWGRPKGKDKGEGQRQSRAEKAMRRIDWYFLPLANPDGYQYS--RQT 449
            |:|::||...:.:.::.           |..:..||.....:.:|:|..|:.|.|||.||  ..:
Zfish    95 REWIAPAFCQHFVKEVL-----------GSYKTDSRVNMLFKNLDFYITPVLNMDGYIYSWLNNS 148

  Fly   450 DRLWTKNRG--YDSVSGCYGVNLDRNFDYGWDGTGSTSNPCKNLYRGAHSFSEPESRAVCSFLSG 512
            .|||.|:|.  ::: |.|.|.:|:|||...|...|.:.|.|..:|.||.:.||||:.||..||..
Zfish   149 TRLWRKSRSPCHEN-STCSGTDLNRNFYANWGMVGISRNCCSEVYNGATALSEPEAEAVTDFLGA 212

  Fly   513 MREYLGAYVSLGGYGQAITYPWGDADYVTENQRNLKQTARRAVLALRRLNQAEYSSGTSYRQKLA 577
            .:.:|..|:::..|||.|..|:|..:....|...|.:....|..|::.::...|..|:|......
Zfish   213 HQNHLLCYLTIHSYGQLILVPYGHPNISAPNYDELMEVGLAAAKAIKAVHGKSYKVGSSPDVLYP 277

  Fly   578 RPGNSADWVQDRIGPQLVFNMFLKDQGRYGYLLPPHYIVESGEEVFE 624
            ..|:|.|:.: .||....|...|:|:|::|::||...|..:.:|.:|
Zfish   278 NSGSSRDFAR-LIGIPYSFTFELRDEGQHGFILPEDQIQPTCQEAYE 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42264NP_572260.2 Propep_M14 <241..293 CDD:280416
M14_CP_A-B_like 328..633 CDD:199844 87/303 (29%)
cpoNP_001139101.1 M14_CP_A-B_like 35..332 CDD:199844 87/303 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593521
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X86
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.