DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3097 and AT5G42320

DIOPT Version :9

Sequence 1:NP_572259.1 Gene:CG3097 / 31503 FlyBaseID:FBgn0029804 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001332683.1 Gene:AT5G42320 / 834237 AraportID:AT5G42320 Length:430 Species:Arabidopsis thaliana


Alignment Length:334 Identity:65/334 - (19%)
Similarity:134/334 - (40%) Gaps:60/334 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 MHWKDYHDLETIYSFMREIRTKFPNIVRLYTIGQTAEGRDLKVLRIS-------ENPRENKKVWI 200
            ::|..||..:.:...:..:..:.|:.:.:..|....:|.:.:|..::       .:.|.|.::.:
plant    40 INWDLYHSSDDLMEQIHSLVHRHPDKLSIELIKSGNKGYNAEVNVVTYCRGGKESDDRSNFRILL 104

  Fly   201 DGGIHAREWISPATVTFILYQLMSDWENQPAHIRG--------LTWYIMPVMNPDGYEYSRTTNR 257
            ..|.|.||.|: :.:.|.:..::|:.:..|....|        |...::|:.||:|.:...:.:.
plant   105 TFGQHGRELIT-SELAFRILSILSEEQFLPNKNGGILKNTLDKLVIKMVPIENPNGRKRVESGDL 168

  Fly   258 LWRKNRSPSRRAQCSGVDLNRNFDIGWNGYGSSTNPCSDTYRGSAPASERETRAVAEFLAKRKYN 322
            ..|:|.        .|||||||:.:.|.......:| |:...|:||.||.||:.:.:...  .::
plant   169 CERRNG--------RGVDLNRNWGVDWGKKEKDYDP-SEENPGTAPFSEPETQIMRKLAI--SFD 222

  Fly   323 LESYLTFHSYGQMIVYPWAYKAVKVKDASVLQRVSSLAAERILQKTGTSYRAAVTHE--VLGIAG 385
            ...::..||..:.:..|:.:|.:      ..:.:.|.....:|:|....:    .|:  ::| :|
plant   223 PHIWINVHSGMEALFMPYDHKNI------TPEGLPSQKMRTLLEKLNKFH----CHDRCMIG-SG 276

  Fly   386 GGSDDWSRAALGVKYVYTI---------------ELRDRGAYGFVLP---PRFIKDTALEGWTVV 432
            |||..:........|:|.:               :...|..:....|   |.|.:  .|..|:..
plant   277 GGSVGYLAHGTATDYIYDVVKAPMAFTFEIYGDNQTASRDCFKMFNPVDLPNFKR--VLNDWSAA 339

  Fly   433 ETVAQAIGP 441
            ......:||
plant   340 FFTIFQLGP 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3097NP_572259.1 Propep_M14 64..118 CDD:280416
M14_CP_A-B_like 148..439 CDD:199844 62/325 (19%)
AT5G42320NP_001332683.1 M14-CPA-like 100..321 CDD:349446 49/243 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D524270at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.