DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3097 and AGBL2

DIOPT Version :9

Sequence 1:NP_572259.1 Gene:CG3097 / 31503 FlyBaseID:FBgn0029804 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_079059.2 Gene:AGBL2 / 79841 HGNCID:26296 Length:902 Species:Homo sapiens


Alignment Length:315 Identity:66/315 - (20%)
Similarity:104/315 - (33%) Gaps:113/315 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 IRTKFPNIVRLYTIGQTAEGRDLKVLRI---SENPRE---NKKVWIDGGIHARE----WISPATV 215
            |:::|   .:|.|:.::..|..:.:|.|   |:.|:|   .|.|.:...:|..|    |:....:
Human   415 IQSQF---CKLQTLCRSLAGNTVYLLTITNPSQTPQEAAAKKAVVLSARVHPGESNGSWVMKGFL 476

  Fly   216 TFIL-----YQLMSDWENQPAHIRGLTWYIMPVMNPDGYEYSRTTNRLWRKNRSPSRRAQCSGVD 275
            .|||     .||:.|.         ..:.::|::||||....             :.|...:|.|
Human   477 DFILSNSPDAQLLRDI---------FVFKVLPMLNPDGVIVG-------------NYRCSLAGRD 519

  Fly   276 LNRNFDIGWNGYGSSTNPCSDTYRGSAP--ASERETRAVAEFLA---------------KRKY-- 321
            |||::    ......:.||....|....  ..|||.....:|..               .|||  
Human   520 LNRHY----KTILKESFPCIWYTRNMIKRLLEEREVLLYCDFHGHSRKNNIFLYGCNNNNRKYWL 580

  Fly   322 -----------NLESYLTFHSYGQMIVYPWAYKAVKVKDAS---VLQRVSSLAAERILQKTGTSY 372
                       |.....:|||..        :|..|.|:.:   |:.|:..|          .||
Human   581 HERVFPLMLCKNAPDKFSFHSCN--------FKVQKCKEGTGRVVMWRMGIL----------NSY 627

  Fly   373 RAAVTHEVLGIAGGGSDDWSRAALGVKYVYTIELRDRGAYGFVLPPRFIKDTALE 427
            ....|.       |||      .||.|......:.|..:.|:     .:.||.|:
Human   628 TMESTF-------GGS------TLGNKRDTHFTIEDLKSLGY-----HVCDTLLD 664

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3097NP_572259.1 Propep_M14 64..118 CDD:280416
M14_CP_A-B_like 148..439 CDD:199844 66/315 (21%)
AGBL2NP_079059.2 GVQW 105..>120 CDD:290611
M14_AGBL2-3_like 407..666 CDD:133117 66/315 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 746..770
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 796..879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.