DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3097 and Agbl3

DIOPT Version :9

Sequence 1:NP_572259.1 Gene:CG3097 / 31503 FlyBaseID:FBgn0029804 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001276585.1 Gene:Agbl3 / 76223 MGIID:1923473 Length:1006 Species:Mus musculus


Alignment Length:421 Identity:75/421 - (17%)
Similarity:134/421 - (31%) Gaps:142/421 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ELPSNLTLLDANEIPQRYDEAQLWRIYNISEAMQKRV---PVGQMLEQKFGGNIWKENSKFLDIS 85
            |:....|:::..:....|:.......|:..||....:   .:|..::. :..|:.::...|..::
Mouse   223 EIVYRFTIVNFTKPASLYNRGMKPLFYSEKEAKTHNIGWQRIGDQIKY-YKNNLGQDGRHFFSLT 286

  Fly    86 IARDQLKAARSFLSAHRLDPQILSH-------NIQSMIDEELLEGIQSSSFGHGRRTKKAARSSM 143
                     .:|...|..|....:|       |:|     |.|.||.|.                
Mouse   287 ---------WTFQFPHSQDTCYFAHCYPYTYSNLQ-----EYLSGINSD---------------- 321

  Fly   144 HWKDYHDLETIYSFMREIRTKF-----------PNIVRLYTIGQTAEGRDLKVLRISENPRENKK 197
                            .:|:||           .|:|.:.||        ...|:.|::.|  |.
Mouse   322 ----------------PVRSKFCKIRVLCHTLARNMVYVLTI--------TTPLKTSDSKR--KA 360

  Fly   198 VWIDGGIHARE----WISPATVTFIL-----YQLMSDWENQPAHIRGLTWYIMPVMNPDGYEYSR 253
            |.:...:|..|    ||....:.:||     .:|:.|         ...:.::|::||||.... 
Mouse   361 VILTARVHPGETNSSWIMKGFLDYILGDSSDARLLRD---------TFIFKVVPMLNPDGVIVG- 415

  Fly   254 TTNRLWRKNRSPSRRAQCSGVDLNRNFDIGWNGYGSSTNPCSDTYRGSAPASERETRAVAEFLAK 318
                        :.|...:|.|||||:              :...:.|.|:.......:...:.|
Mouse   416 ------------NYRCSLAGRDLNRNY--------------TSLLKESFPSVWYTRNMINRLMEK 454

  Fly   319 RKYNLESYLTFHSYGQMIVYPWAY-----KAVKVKDASVLQRVSSLAAER----ILQKTGTSYRA 374
            |:..|...|..||..|.|   :.|     ...|.|...:.||:..|...:    |...:...:..
Mouse   455 REVILYCDLHGHSRKQNI---FMYGCDGSSRSKTKGLYLQQRIFPLMLSKNCPNIFSFSACKFNV 516

  Fly   375 AVTHEVLGIAGGGSDDWSRAALGVKYVYTIE 405
            ..:.|    ..|....|.   :|::..:|:|
Mouse   517 QKSKE----GTGRVVMWK---MGIRNSFTLE 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3097NP_572259.1 Propep_M14 64..118 CDD:280416 8/60 (13%)
M14_CP_A-B_like 148..439 CDD:199844 55/287 (19%)
Agbl3NP_001276585.1 M14_AGBL2-3_like 315..576 CDD:133117 59/314 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 790..810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.