DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3097 and Cpo

DIOPT Version :9

Sequence 1:NP_572259.1 Gene:CG3097 / 31503 FlyBaseID:FBgn0029804 Length:445 Species:Drosophila melanogaster
Sequence 2:XP_038940238.1 Gene:Cpo / 689717 RGDID:1588771 Length:325 Species:Rattus norvegicus


Alignment Length:368 Identity:92/368 - (25%)
Similarity:144/368 - (39%) Gaps:101/368 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 DPQILSHNIQSMIDEELLEGIQSSSFGHGRRTKKAARSSMHWKDYHDL-ETIYSFMREIRTKFPN 167
            |||   |..:.:..:..||     ::.:.|              ||.. ..||.:||::..|:..
  Rat     3 DPQ---HRQEFVSPQRSLE-----TYSYDR--------------YHPWGRGIYQWMRQVSEKYAE 45

  Fly   168 IVRLYTIGQTAEGRDLKVLR----ISENPRENKK-VWIDGGIHAREWISPATVTFIL-------- 219
            ::..:.:..|.|...:..|:    ||.....:|| :|||.||||..||:||...:.|        
  Rat    46 VLTQHFLRMTYETWPMHYLKESAEISLTSSNSKKTIWIDCGIHASRWIAPAFCQWFLREGSVFTC 110

  Fly   220 -------YQLMSDWENQPAHIRGLTW---YIMP-----------------------VMNPDGYEY 251
                   .:.:|...:...:...:.|   .:.|                       |:|.||..|
  Rat   111 LLMLNHAIEYLSTLGSSETYFFPVNWNGIQLAPLQILQNDKDSARIGRLLKELDFXVLNADGXIY 175

  Fly   252 SRTTNRLWRKNRSPSRRAQCSGVDLNRNFDIGWNGY-----GSSTNPCSD-TYRGSAPASERE-T 309
            :.||  .|                   ...:| .||     |:..| |.| |:.|..|..|.| |
  Rat   176 TWTT--AW-------------------TLPVG-QGYLCLHIGTPIN-CQDVTFCGIEPMLEPELT 217

  Fly   310 RAVAEFLAKRKYNLESYLTFHSYGQMIVYPWAYKAVKVKDASVLQRVSSLAAERILQKTGTSYRA 374
            .:.|...|:.|.::..:|...||||:|:.|:.:...|..:...|.:|...||..:..|.||:||.
  Rat   218 PSQALQKARGKKDILCFLIMGSYGQLILTPYGHTKNKPHNYEELIQVGQKAARALKAKHGTNYRV 282

  Fly   375 AVTHEVLGIAGGGSDDWSRAALGVK-YVYTIELRDRGAYGFVL 416
            ....::|.:..|.|.||: ..:|:. :.||.||.|.|.:||.|
  Rat   283 GSGADILYMLSGSSKDWN-GGIGIPLFSYTFELVDNGTHGFAL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3097NP_572259.1 Propep_M14 64..118 CDD:280416 4/13 (31%)
M14_CP_A-B_like 148..439 CDD:199844 85/324 (26%)
CpoXP_038940238.1 Peptidase_M14_like 22..324 CDD:416253 85/339 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.