DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3097 and AGBL5

DIOPT Version :9

Sequence 1:NP_572259.1 Gene:CG3097 / 31503 FlyBaseID:FBgn0029804 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_068603.4 Gene:AGBL5 / 60509 HGNCID:26147 Length:886 Species:Homo sapiens


Alignment Length:148 Identity:33/148 - (22%)
Similarity:61/148 - (41%) Gaps:36/148 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 LETIYSFMRE--------IRTKFPNIVRLYTIGQTAEGRDLKVLRISENPR----ENKKV-WIDG 202
            |:||| :.||        :|.....|...:.:.:..|.|..::...:..||    ..|:: ::..
Human   186 LDTIY-YHRELLCYSLDGLRVDLLTITSCHGLREDREPRLEQLFPDTSTPRPFRFAGKRIFFLSS 249

  Fly   203 GIHAREWISPATVT---FILYQLMSDWENQPAHIRGLTWYIMPVMNPDGY--EYSRTTNRLWRKN 262
            .:|..|  :|::..   |:.:.|..|........|...:.::|::||||.  .:.||.:|     
Human   250 RVHPGE--TPSSFVFNGFLDFILRPDDPRAQTLRRLFVFKLIPMLNPDGVVRGHYRTDSR----- 307

  Fly   263 RSPSRRAQCSGVDLNRNF 280
                      ||:|||.:
Human   308 ----------GVNLNRQY 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3097NP_572259.1 Propep_M14 64..118 CDD:280416
M14_CP_A-B_like 148..439 CDD:199844 33/148 (22%)
AGBL5NP_068603.4 M14_AGBL5_like 176..568 CDD:199860 33/148 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 344..364
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 605..734
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 784..848
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.