DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3097 and agbl2

DIOPT Version :9

Sequence 1:NP_572259.1 Gene:CG3097 / 31503 FlyBaseID:FBgn0029804 Length:445 Species:Drosophila melanogaster
Sequence 2:XP_017209580.1 Gene:agbl2 / 568152 ZFINID:ZDB-GENE-070719-6 Length:1025 Species:Danio rerio


Alignment Length:268 Identity:62/268 - (23%)
Similarity:101/268 - (37%) Gaps:61/268 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 FMRE-----IRTKFPNIVRLYTIGQTAEGRDLKVLRI---SENPRENK---KVWIDGGIHARE-- 208
            ::||     :|..:   .:|..:.::..|..:.||.|   |.:..|.|   .|.:...:|..|  
Zfish   344 YLREVISDPVRAAY---CKLRVLCRSLAGNAVYVLTITAPSSSLAERKAKRAVVVTARVHPGETN 405

  Fly   209 --WISPATVTFILYQLMSDWENQPAHIRGLTWY--IMPVMNPDGYEYSRTTNRLWRKNRSPSRRA 269
              |:....:.|:|..|      ..||:...|:.  ::|::||||....             :.|.
Zfish   406 GSWMMQGFLEFLLSDL------PDAHLLRETFIFKVIPMLNPDGVVVG-------------NYRC 451

  Fly   270 QCSGVDLNRNFDIGWNGYGSSTNPCSDTYRGSAPASERETRAVAEFLAKRKYNLESYLTFHSYGQ 334
            ..:|.|||||:              ....|.|.|........|...||:|:  :..|..||.:.:
Zfish   452 SLAGRDLNRNY--------------RSMLRDSFPCIWYTRNMVKRLLAERE--VVVYCDFHGHSR 500

  Fly   335 MIVYPWAYKAVKVKDAS--VLQRVSSLAAERILQKTGTSYRAAVTHEVLGIAGGGSDDWSRAALG 397
            . ...:.|...:.||||  :.:||..|...: ..|...|:|:..........|.|.....|  ||
Zfish   501 K-NNVFMYGCNERKDASQCLQERVFPLMMSK-NAKDKFSFRSCKFKMHKSKEGTGRIVMWR--LG 561

  Fly   398 VKYVYTIE 405
            ::..||:|
Zfish   562 IRNSYTME 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3097NP_572259.1 Propep_M14 64..118 CDD:280416
M14_CP_A-B_like 148..439 CDD:199844 62/268 (23%)
agbl2XP_017209580.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.