DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3097 and Cpa6

DIOPT Version :9

Sequence 1:NP_572259.1 Gene:CG3097 / 31503 FlyBaseID:FBgn0029804 Length:445 Species:Drosophila melanogaster
Sequence 2:XP_038965675.1 Gene:Cpa6 / 312913 RGDID:1311764 Length:290 Species:Rattus norvegicus


Alignment Length:282 Identity:108/282 - (38%)
Similarity:164/282 - (58%) Gaps:5/282 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 MREIRTKFPNIVRLYTIGQTAEGRDLKVLRISENPRENKK-VWIDGGIHAREWISPATVTFILYQ 221
            |..:....|.:||::.||::.|||.|.::::....:..|: ||||.||||||||.||...:.:.:
  Rat     1 MHHLNQTQPGLVRVFPIGRSFEGRSLLIIQLGRKSQVYKRAVWIDCGIHAREWIGPAFCQWFVKE 65

  Fly   222 LMSDWENQPA---HIRGLTWYIMPVMNPDGYEYSRTTNRLWRKNRSPSRRAQCSGVDLNRNFDIG 283
            .:..::..||   .:..|.:|||||:|.|||.:|.|.:|.|||.||.:.:..|.|||.|||:.:.
  Rat    66 AILTYKTDPAMRKMLNHLYFYIMPVLNVDGYHFSWTHDRFWRKTRSRNSKFHCRGVDANRNWKVK 130

  Fly   284 WNGYGSSTNPCSDTYRGSAPASERETRAVAEFLAKRKYNLESYLTFHSYGQMIVYPWAYKAVKVK 348
            |...|:|.:||.|||.|..|.||.|.:|||.||.|.:..:.:||:||:|.||::||::||...:.
  Rat   131 WCDEGASADPCDDTYCGPFPESEPEVKAVANFLRKHRKRIRAYLSFHAYAQMLLYPYSYKHATIP 195

  Fly   349 DASVLQRVSSLAAERILQKTGTSYRAAVTHEVLGIAGGGSDDWSRAALGVKYVYTIELRDRGAYG 413
            :.|.::..:..|.:.:....|..||.....:.|.::.|.|.||:... |:.|.:..||||.|.:|
  Rat   196 NFSCVEFAAHKAVKALRSVHGIRYRHGPASQTLYVSSGNSMDWAYKN-GIPYSFAFELRDTGYFG 259

  Fly   414 FVLPPRFIKDTALEGWTVVETV 435
            |:||...||.|..|....|:.:
  Rat   260 FLLPEMLIKPTCTETMLAVKNI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3097NP_572259.1 Propep_M14 64..118 CDD:280416
M14_CP_A-B_like 148..439 CDD:199844 108/282 (38%)
Cpa6XP_038965675.1 Peptidase_M14_like 1..289 CDD:416253 108/282 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351599
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_114867
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X86
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.750

Return to query results.
Submit another query.