DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3097 and ccpp-1

DIOPT Version :9

Sequence 1:NP_572259.1 Gene:CG3097 / 31503 FlyBaseID:FBgn0029804 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_491674.2 Gene:ccpp-1 / 172241 WormBaseID:WBGene00018995 Length:1015 Species:Caenorhabditis elegans


Alignment Length:301 Identity:68/301 - (22%)
Similarity:108/301 - (35%) Gaps:91/301 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 YHDLETIYSFMREI-----RTKFPNI-VRLYTIGQTAEGRDLKVLRISE---------------- 190
            ||...| |||:...     :.|..|: .|...||.:..|..:|:|.|:.                
 Worm   725 YHYPYT-YSFLNSSLSMLKKRKQENVYCREDVIGHSLAGNPIKMLTITTPASAAEIAAREVIVLS 788

  Fly   191 ---NPRENKKVWIDGGIHAREWISPATVTFILYQLMSDWENQPAHIR-GLTWYIMPVMNPDGYEY 251
               :|.|....||..|              ||..|:....|:...:| ...:.|:|::||||   
 Worm   789 ARVHPGETNASWIMQG--------------ILENLLCRQSNEMYRLRESFIFKIVPMINPDG--- 836

  Fly   252 SRTTNRLWRKNRSPSRRAQCSGVDLNRNFDIGWNGYGSSTNPCSDTYRGSAPASERETRAVAEFL 316
              .||        .|.|...:|:||||.    |:....:.:|  :.:         .|:|:.::|
 Worm   837 --VTN--------GSHRCSLAGIDLNRM----WDRPNEALHP--EVF---------ATKAIIQYL 876

  Fly   317 A----KRKYNLESYLTFHS---------YGQMIVYPWAYKAVKVKDASVLQRVSSLAAERILQKT 368
            .    |:.:   :|:..|.         ||......|....|....|:.|:....||..:.|:.|
 Worm   877 CEVANKKPF---AYVDIHGHSKKWDYFVYGNNASESWRADDVLDVGAAQLEEELHLALPKALEAT 938

  Fly   369 GTS-YRAAVTHEVLGIAGGGS---DDWSRAALGVKYVYTIE 405
            ..| :.|:.....:..|...|   :.|.:  .||...||:|
 Worm   939 CPSRFNASECRFNITRAKESSARVNVWRQ--FGVSTAYTLE 977

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3097NP_572259.1 Propep_M14 64..118 CDD:280416
M14_CP_A-B_like 148..439 CDD:199844 68/301 (23%)
ccpp-1NP_491674.2 M14_Nna1_like_2 738..1011 CDD:199859 62/287 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.